KEGG   Oscillatoria nigro-viridis: Osc7112_4235Help
Entry
Osc7112_4235      CDS       T02375                                 

Definition
(GenBank) N-acetylglucosamine 6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00520  Amino sugar and nucleotide sugar metabolism
oni01100  Metabolic pathways
oni01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Osc7112_4235
Enzymes [BR:oni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Osc7112_4235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AFZ08558
UniProt: K9VKG3
Position
complement(5022494..5023723)
Genome map
AA seq 409 aa AA seqDB search
MTEATTPTATPTDILNARLPGCKDLQMLAVDETGIIQEVLPMDAVFKRICPPDLQVLDVA
GNWLSLGGVDLQINGALGFAFPDLESKHMEILPKICQFLWNQGVDAFLPTLVTTSVDKFR
RSLSTIADYIRTVQTAAPATINPKTAEILGVHLEGPFLNPQKRGAHPVEFLLPLTIENVK
QVLGDCADIVKIITLAPELDSTGEVISYLQSLGISVSLGHSQATAEQAQQAFARGASMVT
HAFNAMPSLHHREPGLLGAAIVYPGVKCGLIADGQHVSPTMIDFLLRAGRYQKGVFLVSD
ALAPLGLPDGVYPWDSRQIEVRKGTAWVRLDYHSPLESATLAGTTLPLLAGVQNLVEWGI
CDAESAIALATESPRKAIGISGIIGKSASQLLRWNLNAATKQLTWYRLF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagccacaaccccaactgccacccccacagatattctcaatgctcgcctcccc
ggttgcaaggatttgcagatgcttgctgttgacgaaacgggaatcattcaagaagttttg
ccgatggacgcggtatttaaacggatttgtcctcccgatttgcaagtgcttgatgtagca
ggcaattggctgtctctgggcggtgttgacttgcagattaacggggctctcggttttgct
tttcccgatttagaaagcaagcatatggaaattttgccgaaaatttgtcaatttttgtgg
aatcagggagtggatgcttttttgccgactttggtgacaacttcggtggataagtttagg
cgatcgctctcgactatagctgattatatccgaactgtacaaaccgctgctcccgcaaca
attaatcccaaaacagcggaaattctcggcgttcacctcgaaggcccttttctcaacccc
cagaagcgaggcgctcacccagttgagtttttgttaccgctaactatagaaaatgtcaag
caagttttaggagattgtgccgatattgtcaaaataattactttagcgccggagttagac
agcactggcgaagtcatttcctatttgcaaagtttgggaatttccgtcagtctcggacac
tcccaagcgacggcagagcaagcccaacaagcatttgcccggggagcttcaatggtaact
cacgcttttaatgcgatgccgagtttgcaccacagagaaccgggtttgttgggagcggcg
attgtttatccgggcgtaaaatgcggtttaattgctgacgggcagcacgtttctccgaca
atgattgattttttgctacgcgctggtaggtatcaaaaaggcgtttttttagtgagcgat
gctttggctcctttgggtttgcctgacggtgtttatccttgggattcccgacaaattgaa
gtcagaaaaggtacagcttgggtaagattagattaccactcgcccctggaatctgctact
ttggcgggtacaactctgccgctgttggcgggagtgcagaatttggtggagtggggaatt
tgcgatgccgaaagtgcgatcgccctggcaactgaatctccaagaaaggcgatcggaatt
tcgggaattattggcaaatcggcaagtcaattgttgcgctggaatttaaatgcggcgaca
aagcaattgacttggtatcgactcttttaa

DBGET integrated database retrieval system