KEGG   Oscillatoria nigro-viridis: Osc7112_5032Help
Entry
Osc7112_5032      CDS       T02375                                 

Definition
(GenBank) ferredoxin protochlorophyllide reductase subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00860  Porphyrin and chlorophyll metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Osc7112_5032
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Osc7112_5032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: AFZ09298
UniProt: K9VMG5
Position
6017624..6019033
Genome map
AA seq 469 aa AA seqDB search
MTAITTNEPEALNFECETGNYHTFCPISCVAWLYQKIEDSFFLVIGTKTCGYFLQNAMGV
MIFAEPRYAMAELEEGDISAQLNDYDELKRLCLQIKRDRNPSVIVWIGTCTTEIIKMDLE
GLAPKLEAEIGIPIVTARANGLDYAFTQGEDTVLAAMAAKCPDKAPVVEAQKQERNAISQ
LLNFGKKKEEVAADESEYVKHTPLVLFGSLPDPVVTQLTLELKKQGIKVSGWLPSKRYTE
LPVLEEGYYVSGMNPFLSRTASTLMRRRKCKLIGAPFPIGPDGTRAWIEKICSVLGIEPK
GLDEREAQIWAGLEDYLQIIRGKSVFFMGDNLLEISLARFLIRCGMTCPEIGIPYMDKRY
QAAELALLEKTCQEMGVPTPRIVEKPDNYNQLQRIYEQNIDLVITGMAHANPLEARGINT
KWSVEFTFAQIHGFGNARDILELVTRPLRRNNSLKDLGWGDLVKKEAKV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgactgctattactactaatgaaccggaagctttaaactttgaatgcgaaacaggcaat
tatcacactttttgtccgattagctgcgtagcttggctttatcaaaaaattgaagatagt
tttttcttggtcatcggtaccaagacttgcggctatttcttgcaaaacgccatgggcgtg
atgatttttgctgagcctcgctatgcgatggctgagttggaagagggcgatatttccgct
cagttaaacgattatgatgagttgaagcggctgtgcttgcaaattaagcgcgatcgcaac
cccagtgtaattgtttggatcggcacttgcaccaccgaaatcatcaaaatggacttggaa
gggttagcgccgaaactcgaagcagaaattggcattcccatcgtcacagcccgcgctaac
ggcttggattacgcttttactcaaggggaagataccgttttggcagctatggctgctaaa
tgccctgacaaagctccggttgtagaagctcagaagcaagaaagaaatgctatctctcaa
ctgctgaatttcggcaagaaaaaagaggaagttgcagcagatgaatcggaatatgtcaag
cacacaccgctggtacttttcggttctttgcccgacccggttgttactcagctaactcta
gaattgaagaagcaaggaatcaaagtttccggttggcttccttccaagcgctacactgaa
ttgccagtcttggaagaaggttattatgtatcgggcatgaatccgttcttgtcgcgcaca
gcttctacgttgatgcgccgccgcaagtgcaagctaattggtgcgccattcccgatcggc
cctgacggaactcgcgcttggattgagaagatttgctcagtgttgggaattgaaccaaaa
ggtttggacgaacgggaagcgcaaatttgggctggtttggaagattacctgcaaatcatt
cgcggcaaatctgtcttctttatgggagacaatttgctggagatttctttagcacgtttc
ttgattcgctgcggcatgacttgcccggaaattggcattccttacatggacaagcgctat
caggcggccgaattggcgttgttagaaaagacttgtcaggagatgggagttcctactcct
cggattgtggagaaaccagacaattacaatcagttgcagcggatttacgagcagaatatt
gacttggtgattacaggtatggctcacgctaatcctttggaagcgcggggaattaatact
aaatggtctgttgagttcacttttgctcagattcacggctttggtaatgcgcgggatatt
ttggagttggtgactcgtccgctgcgccggaataattcgctgaaggatttgggctggggt
gatttggtgaagaaagaagcgaaggtttag

DBGET integrated database retrieval system