KEGG   Oscillatoria nigro-viridis: Osc7112_5447Help
Entry
Osc7112_5447      CDS       T02375                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00790  Folate biosynthesis
oni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Osc7112_5447
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oni04147]
    Osc7112_5447
Enzymes [BR:oni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     Osc7112_5447
Exosome [BR:oni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Osc7112_5447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AFZ09680
UniProt: K9VR38
Position
complement(6494494..6494844)
Genome map
AA seq 116 aa AA seqDB search
MEPLAKERCAACRPNSPRVTAYEIVQLKPEIPDWNFIEKNGIPQLERTYKFPDFKTAIAF
TNSVGEVAETQGHHPALLTEWGKVTVTWWTHAISGLHRNDFIMAAKTDAIANQFPK
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggaacctttagcaaaagaacgctgtgcagcctgccgcccaaactctccccgcgtcaca
gcatacgaaattgtccagctcaaacctgaaattcccgactggaattttatcgaaaaaaat
ggcattccccaattagaacgcacctacaaattcccggatttcaaaactgcgatcgccttt
acaaacagcgtcggcgaagtagcagaaacccaaggacatcaccccgcactgttaaccgag
tggggaaaagttaccgttacttggtggactcacgcgatttctggactgcaccggaatgat
tttattatggcggcgaaaaccgatgcgatcgccaatcaattcccgaaataa

DBGET integrated database retrieval system