KEGG   Oreochromis niloticus (Nile tilapia): 100534483Help
Entry
100534483         CDS       T06104                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00480  Glutathione metabolism
onl00590  Arachidonic acid metabolism
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100534483
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100534483
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100534483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin NdhM
Motif
Other DBs
NCBI-GeneID: 100534483
NCBI-ProteinID: NP_001266640
UniProt: C9EIT1
Position
LG5
AA seq 191 aa AA seqDB search
MAGHLKRFYDLTAKLLSGETLRFSALKDKVVLIENVASLUGTTTRDYTQVNDLHSRYSAE
GLVILGVPCNQFGHQENCKNDEILRSLKYVRPGNGFEPKFQLLEKVDVNGKDAHPLFVYL
KEKLPFPCDDALGLMNDPKYIIWSPVCRNDVSWNFEKFLVGPDGEPYKRYSRNFLTSDIE
ADIKQLLKRIK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctggccatttgaaaaggttttacgacctgacagctaagctgttgtctggagaaact
ctccgtttctctgcactaaaggacaaagttgtacttattgaaaatgtggcgtctctctga
ggaacgacaaccagggactacactcaagtgaacgaccttcattctcgctactccgccgaa
ggtctcgttattttgggtgtgccctgcaatcagtttggacatcaggagaactgcaagaac
gatgaaatcctaagatctctgaagtatgtccgtccagggaatggctttgaaccaaagttc
cagctcctcgagaaggtggatgtgaatggaaaggatgcccaccccttgtttgtctatctg
aaggaaaaacttccattcccctgcgatgatgccctgggtctcatgaatgatccaaagtac
atcatttggagtccagtgtgtaggaatgacgtatcctggaactttgagaagttcctggtt
ggtcctgacggggaaccttacaagcgctacagcagaaatttcctgacaagtgacatcgag
gcagatattaaacagcttcttaagagaatcaaataa

DBGET integrated database retrieval system