KEGG   Oreochromis niloticus (Nile tilapia): 100694014Help
Entry
100694014         CDS       T06104                                 

Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100694014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:onl04040]
    100694014
Ion channels [BR:onl04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100694014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061 Comm
Motif
Other DBs
NCBI-GeneID: 100694014
NCBI-ProteinID: XP_005463861
Ensembl: ENSONIG00000000348
AA seq 948 aa AA seqDB search
MRPQSCPLPSALLPLLLGLCSGTSFPTNINIGGLFPGDSHEYEVFRFALAQNQDIPKLVP
QVDMVDTSSSFAMTYAFCSQFSKGVYAIMGLYDRRTVNMLMSFCGSLHVCFVTPSFPVQT
NNQFVLQLRPQLQEPLMALLEHFYWTRFVYMYSSDSGLAVLQRILDTAAERSWQVTSVNL
DSLTEPAFIKLLADLDYKKDFQIIIDCELKRLNYILNLIAAQKRNLKNYHYILANLGFLD
LNVTEFQKLGPNVTGFQLVNRSDPAVQKINQNWLDFDNKDLKVARRRLKYTGALTYDGVS
VMATAFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRLEGLTGHVQFDER
GHRTNYTLTVMELSHIGPRKIGFWNEKRGYVNTAIYRPMQEEFYNVQNKTYIVTTILEAP
YMMLKKNHEQFLGNDKYEGYCAELAAEIAKHVGFTYRLELVGDGKYGARDPETKMWNGMV
GELVYGKADMAVAPLTITLVREQVIDFTKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYE
IWMCIVFAYIGVSVVLFLVSRFSPYEWNGEESDDEDETAPSSSRRAQASSSAEHTHSPGF
SQAQGQNQNQQKEKETPEYTNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFF
TLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFRRSKIAVFE
KMWSYMRSADPSVFVKSTSEGVIRVRKSKGKYAYLLESSMNEYIEQRKPCDTMKVGGNLD
SKGYGVATPKGSPLRNPVNLAVLKLNEQGLLDKLKNRWWYDKGECGTGGRDSKDKTSALS
LSNVAGVFYILIGGLGLAMLVALVEFCYKSRIESRRMKELIDAAMMSTSLGGIAVAGGGA
VAGGLGVGPSGLGGENGRVVAHDFPKAGAQGLPCMSKAAGLGLSSTGM
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcagagctgcccgctgccctcggccctgctcccgctgctgctcgggctctgc
agcggcacaagtttcccaactaacatcaacataggaggccttttccccggtgactcccat
gagtatgaggtgtttcgtttcgccctggcacaaaaccaggacatccccaagctggtgcca
caggtggacatggtggacacgagcagcagcttcgccatgacctacgccttctgctcacag
ttctctaagggcgtgtacgccatcatgggtctgtatgaccggcggacggtcaacatgctg
atgtccttctgtggctctctgcacgtctgcttcgtcacgccgtccttccccgtgcagacc
aacaaccagttcgtcctgcagctgcggccccagctgcaggagcctctcatggccctgctg
gagcacttctactggaccaggttcgtctacatgtacagctccgactcaggtttggcagtg
ttgcagaggatcctggacacggcggcagaacgaagttggcaggtcacctcggttaacctg
gatagtctcacagagccggccttcatcaagctgctggctgacctcgactacaagaaggac
ttccagatcatcatcgactgcgagctgaaacgcctcaactacatcctcaacctgattgct
gctcagaagaggaacttgaagaactaccactacatcctggccaatctgggcttcttggac
ctgaacgtcacagaatttcagaagcttggaccgaacgtgaccggcttccagctggtgaat
cggtcagatccagctgtgcagaaaatcaatcagaactggctggactttgacaacaaagac
ctcaaagtggctcgcaggaggctcaagtacacaggagctctgacctatgatggtgtcagc
gtcatggcaacggcattccagaatctgcggaggcaacggatcgacatctctcgccggggc
aacgcaggggagtgcctggccaacccgcccgctccgtggggacagggcatcgatatccag
agagccctgcagcaggttcgtctggaggggctgacgggtcacgtccagttcgatgagcgt
ggacatcgaaccaactacactctgactgtgatggagctcagccacattggaccccggaag
atcggcttctggaatgagaagcgaggctatgtgaacactgccatctacaggccgatgcag
gaggagttttacaatgtgcagaacaaaacctacatcgtcactaccatcctggaagctccc
tacatgatgctaaagaagaaccacgagcagtttttgggaaacgataaatatgaaggttac
tgtgctgagctcgccgcggagatcgccaaacacgtcgggttcacgtaccgccttgagctg
gtaggcgacggcaaatacggcgccagagaccccgaaacaaagatgtggaatggcatggtg
ggagagctggtgtatgggaaggcggacatggcggtggccccgctgaccatcactctggtg
cgagagcaggtgatcgacttcacaaaacccttcatgtctctgggaatctccatcatgatc
aagaaacctaccaagtccaaaccgggcgtcttctctttcctcgacccgctggcctacgag
atctggatgtgcatcgtctttgcctacatcggggtcagcgtggtgctcttcctggtgagt
cggttcagtccttacgaatggaacggtgaggagtctgatgatgaagatgaaactgctccc
tcttcttctcgaagagctcaggcctcttcatccgcagaacatacccactctccagggttc
tcccaggctcaggggcagaaccagaaccagcagaaggaaaaggagaccccagaatacacc
aatgactttggcatctttaattctctgtggttctcactcggggcgtttatgcagcagggc
tgtgacatctctcccaggtctctctcaggtcgaattgtcggaggagtttggtggtttttc
accctcatcatcatctcctcctacacagccaacctggcagccttcctcaccgtagagagg
atggtgtcccccatagagagtgcagaggacctggccaagcaaacagagattgcctatggt
accttggacggagggtccactaaagaattcttcaggcggtcaaagattgcagtgttcgag
aagatgtggtcgtacatgcggagtgcagacccatccgtcttcgtcaagagcactagtgaa
ggcgtgatacgggtcagaaagtcaaaagggaaatatgcctacctgctggagtcctccatg
aatgagtacattgagcagaggaagccctgcgacaccatgaaagtaggaggcaacctggac
tctaaaggctatggagtggccacgcctaaaggatcccccctcagaaaccctgttaacttg
gcagtgttaaaactgaacgagcagggcctgttggacaaattgaaaaacagatggtggtat
gacaagggagagtgcggcaccgggggaagggactccaaggacaaaactagcgcactcagt
ctgagcaatgtagctggagttttctacatcctgattggtgggctgggcctggccatgctg
gtggctctggtcgagttctgctacaagtctcggattgagtcaagaaggatgaaggagctt
attgatgccgccatgatgagcaccagccttggcgggatagcggtggcaggaggaggagcg
gttgctggtggtttaggagttggaccgtcgggacttggaggggagaatggccgcgtggtg
gcccacgatttcccaaaagccggagctcagggtttaccctgcatgagcaaagcagccggc
ctgggactgtcctccacaggcatgtga

DBGET integrated database retrieval system