KEGG   Oreochromis niloticus (Nile tilapia): 100694325Help
Entry
100694325         CDS       T06104                                 

Gene name
pla2g4a
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00564  Glycerophospholipid metabolism
onl00565  Ether lipid metabolism
onl00590  Arachidonic acid metabolism
onl00591  Linoleic acid metabolism
onl00592  alpha-Linolenic acid metabolism
onl01100  Metabolic pathways
onl04010  MAPK signaling pathway
onl04217  Necroptosis
onl04270  Vascular smooth muscle contraction
onl04370  VEGF signaling pathway
onl04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100694325 (pla2g4a)
   00565 Ether lipid metabolism
    100694325 (pla2g4a)
   00590 Arachidonic acid metabolism
    100694325 (pla2g4a)
   00591 Linoleic acid metabolism
    100694325 (pla2g4a)
   00592 alpha-Linolenic acid metabolism
    100694325 (pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100694325 (pla2g4a)
   04370 VEGF signaling pathway
    100694325 (pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100694325 (pla2g4a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100694325 (pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100694325 (pla2g4a)
Enzymes [BR:onl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100694325 (pla2g4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 100694325
NCBI-ProteinID: XP_003445168
Ensembl: ENSONIG00000010006
UniProt: I3JUN8
AA seq 745 aa AA seqDB search
MTMASNIIVEQQFSHKFTVTVVRAQNVTKGALGDLLDTPDPYVELFIPTAPESRKRTKHI
DNDINPKWNETFHFILDPNQHNVLELTLMDANYVMDETLGTASFEISKLKVGQTKMEVFL
IGKATKVHLEMSLEICTNLDLRFSHTLCDKEKQFREARREKVMLGIKKLLCTEDPCHPEE
VPVVAIAGSGGGFRAMVGFSGVMKALFESGVLDCATYIAGLSGSTWYMSTLYANPDFPNK
GPKDINNELMKRVSSNPLRLLMPKHITHYIQALWTKKASGQPVTFADIFGMLIGETLIPS
RMGIKLSDIQEKINQAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMTPD
LFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVKDTAGGSTMEEELEQIKPQ
HIVGEDTLDDDEPRKGGTENQEADEEFHRTAQASWVQRMFTSVFGDSALFNTREGRAGKV
HNFMLGLNLNTSIPYSPLLEITHAMTPEEEVDAVTDPDEFDRIYEPLDVKSKKIHVVDSG
LTYNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKIDPKV
FDREGLKECYVFKPKRGEKNCPTVIHFVLVNINFRKFKAPGVPRETEKEKELADFDIFDD
PETPYSTFNFQYSNEAFIQLHDLMEFNTLNNLEVIKEAIKDCITSQKENPSSVSRPFALS
EIPKKKSLKRDHQGKPVNHLGNNSQ
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggcttccaatataattgtggagcagcagttttctcacaaattcacagtgact
gtagttcgagctcagaacgtcaccaagggagcgctgggcgacctgctggacactccagac
ccatatgtggagcttttcatcccgacggcccctgaaagcagaaagaggaccaagcacata
gacaacgacatcaacccaaaatggaacgagacctttcatttcattttagaccccaaccag
cacaacgttctggagttaacattaatggatgccaactacgtgatggatgagacgcttggg
acagcatccttcgaaatctccaaactcaaagtgggccagacaaagatggaggtgttcctc
attggcaaagcaaccaaagtgcacttagagatgtcactggagatctgtacaaacctggac
ctgcggttcagccacaccctttgtgacaaggagaagcaatttagagaagcccgtcgagaa
aaggtgatgctcggcatcaagaagctgctatgcactgaggatccttgtcacccagaagag
gtgccagtggtagcaatagccgggtcaggaggcggtttccgcgccatggtcggtttttcg
ggtgttatgaaggccctgtttgagtccggggtcctcgactgtgccacatatattgctggc
ctctctggatccacatggtacatgtcaactctctacgccaaccctgactttccaaataag
ggcccgaaggacatcaacaatgagttgatgaagagagttagcagtaacccacttcggctg
ttgatgcccaagcacatcacccactatatccaggccctgtggaccaaaaaggcctcagga
cagccggttacttttgcagatatctttggtatgctcataggagagacacttataccctcg
agaatgggcatcaagctaagcgacatccaggagaaaataaaccaagcccagtgtccgctt
cctcttttcacatgtctgcatgtgaagccggatgtttctgagctcatgtttgcagactgg
gtggagtttagcccgtatgaaatcgggatggcaaagtacggcaccttcatgacccctgac
ctatttggaagcaagttcttcatgggaactgttgtgaagaagtacgaggaaaaccctctt
cattttctgatgggtgtgtggggaagtgccttctcaattctgttcaacagagtgctgggg
gtcaaggacacagctggtggcagcaccatggaggaggagttagagcagatcaaaccacag
cacatcgttggagaagacaccctggacgacgacgagccacgcaaaggtgggacagaaaac
caggaggcagatgaggagtttcatcgaaccgctcaggccagctgggttcaacgtatgttc
acgtcagtcttcggcgactctgctttgttcaacacaagggagggccgtgctggaaaggtg
cataacttcatgctgggcctgaacctgaacaccagcatcccatactctccattacttgag
ataacacatgctatgacacctgaagaggaggtggatgctgtaacagatcccgatgagttt
gatcgaatctacgagcctctggatgtgaagagcaagaagatccacgtagtggacagcggc
ctgacctacaaccttccctacccccttatcctgcgcccgcagcgcggcgtcgacctcatc
atctcctttgacttttcggcacgaccgagtgactcaagccctccgttcaaggagcttctc
ctcgctgagaaatgggctagaatgaacaagctgccattccccaagatcgaccccaaagtc
tttgaccgtgaaggtctgaaggaatgctacgtcttcaaaccaaagagaggtgaaaagaac
tgcccgacggtcatccactttgtcctcgtcaacatcaacttcaggaaattcaaagcgcct
ggcgttcccagggagaccgagaaggagaaggagctggccgattttgacatttttgacgac
cctgagacaccatactccaccttcaacttccaatactccaacgaagcctttatccagctt
catgacctgatggagttcaacactctcaacaacctggaggttattaaagaagccatcaag
gactgcatcacgtctcagaaggagaatccctcgagcgtctctcgtccttttgccctcagt
gagatcccaaaaaagaagagtctcaaacgagatcatcaaggaaagcccgtgaatcacctt
gggaataatagccagtag

DBGET integrated database retrieval system