KEGG   Oreochromis niloticus (Nile tilapia): 100695334Help
Entry
100695334         CDS       T06104                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04020  Calcium signaling pathway
onl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100695334
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100695334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:onl04030]
    100695334
G protein-coupled receptors [BR:onl04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100695334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx CBFB_NFYA DUF5409
Motif
Other DBs
NCBI-GeneID: 100695334
NCBI-ProteinID: XP_019215726
AA seq 358 aa AA seqDB search
MDNSTLGWLGDDNTSLQLELQSCTLLRHQVSRIFLYAFLSVGIICTVVGNFLVVLSIAYF
KQLQSPTNCFVMSLAVADCLVGLVVMPYSMIRTVEGCWYFGSLFCRIHSSLDVMLCTASI
FHLSCIAFDRYYAVCNPLVYSLKMSHRRVALLIAVCWLVPILISFGPIMLDLHVAGVDML
IPKDLCVFLVSRIYAVMASLVAFYLPMAIMLIAYWKIFKAAKRQARQISAMESQMAAGVG
KDSSKKKRHRNAMKRERKAAKTLGIIMGVFLIFWMPFFTVNIVDPFIEYSTEVVLWDLFL
WLGYINSSLNPFLYGLFNRSFRRAFLMFMGCGVCLPGSSPGMELSHTRKEANECAEQS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggataacagcaccttgggatggctcggagatgataacacatctcttcaactcgaactt
caatcgtgtactttattgaggcatcaagtctctcgcattttcctgtatgctttcctctcg
gttggcatcatctgcacagttgtgggcaacttcctggtggtcttgtccattgcttacttc
aagcagctgcagtcccccacaaactgcttcgtcatgtccctggcggtggctgactgccta
gttggccttgtagtgatgccttatagtatgattcgaactgtggaggggtgctggtacttt
ggttctcttttttgtcggatacactctagcctagatgttatgctctgcactgcctccata
tttcatctcagctgcatcgccttcgaccgttactatgccgtctgtaaccctctagtttac
tctttaaagatgagccacaggcgggtagctctcctcatcgctgtgtgttggcttgtcccc
atactcatttcctttggccccattatgctagaccttcatgttgctggtgtagacatgctg
attcctaaagatttatgtgtgttcttggtcagtcgcatttatgctgtcatggcttcttta
gtagccttttacctgcccatggcaatcatgctaatagcctactggaagatcttcaaagct
gccaagcggcaggccaggcagatcagtgccatggaaagccagatggctgctggagtgggt
aaagactcaagcaagaaaaaaagacaccggaatgccatgaagagggagagaaaggcagcg
aaaactttaggtatcatcatgggagtttttctcatcttctggatgcccttctttactgtc
aacatcgtggacccgttcattgaatacagcacagaggtggtcctctgggatctctttctg
tggttagggtatatcaactcatctctaaaccctttcctgtatggtttgttcaatcgttcc
tttcggagggcgttcctcatgtttatgggctgcggggtatgcctgcccggatcatcccct
gggatggaattatcgcatactcgaaaagaggcaaatgaatgtgcagagcaatcctaa

DBGET integrated database retrieval system