KEGG   Oreochromis niloticus (Nile tilapia): 100696354
Entry
100696354         CDS       T06104                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:onl01002]
    100696354 (adamts13)
Enzymes [BR:onl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100696354 (adamts13)
Peptidases and inhibitors [BR:onl01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100696354 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_spondin Reprolysin_4 TSP1_CCN Reprolysin_3 Reprolysin_5 ADAM_spacer1 Reprolysin_2 CUB Peptidase_M10
Other DBs
NCBI-GeneID: 100696354
NCBI-ProteinID: XP_013127045
Ensembl: ENSONIG00000010925
AA seq 1385 aa
MVFMTLFCLLLLLRPGLSALMISPLEKPFHHSTSPGALSYPGSSHSTVSERLRRAAVVPD
ITHLELLVVVGPDVQQVHRQDTERYILTNLNIASELLRDMTLGANMRVHLVRMIILSEPE
PEIQLSTNITSSLRSVCDWGRRINPSNDTDPLHADLLLYITRYDLVLPDGNKQVRGVTQL
GGACSSEWSCVITEDTGFDLGITIAHEIGHSFGINHDGVANTCSRSGFMMASDGGYNSVD
LTWSPCSRQQLLTFFSEGKAECVKDLPAMEGSLQDWKPGLYYGVDDQCRIAFGSTAKACS
FTNNDLPACRFLSCHVNLDDNSSCKRLLVPLLDGTECGPNQWCLKGRCVSPDDLSSPDVV
HGSWSGWSEFSSCSRTCGGGVALRTRQCNNPRPAFGGNDCEGPDIEAELCNQQPCERTQL
NFMAEQCSQTDNHPLYLPPNSASFYTWIPALGFTQGDEQCRYMCQSDGENFIVSRGSQFV
DGTRCETDSPPPFGATAACLRGRCQLFGCDGVLHSGKVRDICGVCGGNGSSCRLISDSYS
GGQAREYITFVSVPVNATQVHIVNRAPLFTHMAVKAGEKYIVSGMGSMALNMTHPSPLDE
NRLEYRIHLTPDLLPEMEELLVPGPLQQQIKVQIYRKYGKEYGEKTNPNISYQFYVPTRN
SSQMDVLPKGKWSVFTTPCSVSCGSGVRRHVYICADEETSKPLEEHDCLTPRPTTPLYTT
CHLAPCPPRWTAGTFGPCSASCGGGERVRPVRCVQKHGSDVVKVPESKCSPDTAPHAIEK
CNLQHCPARWHASEPGNCSAICGPGEAKRIVSCVRPEGGVDVEVDQSFCSKQIKPPDSVP
CVVDVCPIGWESDREEQPSLKSGLLPRSSQPRVYVWSPVISPCSKTCGNGTLQVWFSCVD
HQTTLGVPDFHCDASTKPHPKSEICSTLPCPPVWRSKQGVCSVTCGGGVANRVLYCAREA
EGEEVVVEDSECSNFPKPTAVVSCNTHSCPARWKVFRTLPCSVSCDLGVAQRVVSCVQFI
HGKESVVAEGNCHAAVKPAITVPCLVQVCTFRWEVKPWSQCCVSLKCSVSCGYGIQSRAV
SCMGPSKPEPLSPLICMHMPKPITIQGCYTGSCRDVPSTSATPLHSTPSPKNISQHRIRQ
LSPSPTEAFTIPVTPVATTTLTPTHKSSACGQLLLEESGTVDLTDVTDRCVVSIGRPLDE
VIHIKVVSSSLDCRKKEYVAFFDRLAFMRKCAHVGGTELTTRTNVLLVRQNLLTPGSGVV
FTYSSQKNKKRSHHQDCDIQLFSPSGVFENPITSSTNHTCRVLINAPPSVKIRIQALHIG
LVFNTTNSQSTYITIRDMDVLKTNVFKGNQLFQWHSSGNMAEVEFHGDYLHSEGSFRARY
SFVRL
NT seq 4158 nt   +upstreamnt  +downstreamnt
atggtttttatgactctgttctgtctgctgctgctgctgcggcctggcttaagcgcacta
atgatttctccattggaaaagccttttcatcactcgaccagtccaggagcactttcctat
ccaggttcttctcattccacagtaagtgagcgactgcgtcgggcagctgtggtgcctgat
atcacccatctggagctactggtagtggtggggcctgatgtccagcaggtccacaggcag
gacacagaaagatacatcctcaccaacctcaacattgcctcagagctgttgagagacatg
accctgggcgccaacatgagggtgcacctggtccgcatgatcatcctgtcagagccagag
ccagagatccagctgtctaccaacatcacttcttctctcagaagtgtgtgtgactggggc
agaaggattaacccttcaaatgacacggacccgctacacgcagatcttctgctgtacatt
acaaggtatgacctggtgttgcctgatggaaacaagcaggtcaggggagtaacacagctc
ggtggggcttgctccagtgaatggagctgtgtgattacagaggacactggctttgacctg
ggaatcaccatcgctcatgaaattggccacagctttggaatcaaccatgacggagtagca
aacacctgcagcaggagtgggttcatgatggcctctgacggaggctacaacagtgtggat
ttgacctggtctccctgcagcagacagcagcttcttacattcttcagtgaagggaaggcg
gaatgtgtaaaagatctccctgcaatggaaggatccctgcaagactggaagcctgggctc
tactatggcgtggatgaccagtgtcgtatagcttttggtagcactgcgaaagcctgctct
ttcaccaataatgacctgccagcttgtcgttttctgtcttgccacgtcaatctagacgac
aatagctcctgcaaacggctcttagtgccacttctggatgggacagagtgcggtcctaat
cagtggtgtctaaaggggcgctgtgtgtctccagatgatctcagctcccctgatgtggtt
cacggctcctggtccggctggtctgagttttcttcctgctcgaggacgtgtggtggcgga
gtcgcacttcgtacgcggcaatgtaacaacccaagacctgcatttggagggaatgattgt
gagggcccagatatcgaggctgaactttgtaaccagcaaccttgtgagcgcactcaactt
aatttcatggcagagcagtgctcccagacagataaccatcccctctacctgccaccaaac
agtgcttccttctacacatggatccctgcattaggcttcacacagggggatgaacagtgc
agatatatgtgccagtcagatggagaaaacttcatagtgagccgtggctctcagtttgtg
gatggtactcgctgtgagacagacagcccccctcccttcggcgctacagcagcttgtttg
agaggcagatgccagctatttggctgtgacggtgtcctgcactctggaaaagtaagggat
atctgtggggtgtgtggtggaaatgggtcatcctgcaggctgatatctgactcctacagt
ggtggtcaggccagagagtacatcacctttgtctcggtgccagtaaatgccacacaggtt
catattgtcaacagggcacctctcttcactcatatggctgtaaaggctggggagaagtac
attgtgtctggaatgggcagcatggctctgaatatgacccacccttccccgctggatgaa
aaccgcctggagtaccgaatccatctaacacctgaccttttgcctgagatggaggagctg
ctcgtgcctgggcctctgcaacagcagataaaagtacagatctatcgcaaatatggaaaa
gaatacggagaaaaaacaaatccgaacattagctaccagttctatgtgcctaccagaaac
agcagccaaatggatgtcttacccaaaggcaaatggtctgttttcacaacaccctgctct
gtgtcttgtggatcaggtgttcggaggcatgtttatatttgtgcagatgaagagaccagc
aaacctttggaggaacatgactgtttaacaccccgtccaaccacaccgctctacacaacc
tgtcatcttgcaccctgtccccccagatggactgcagggacgtttgggccttgtagcgcc
tcctgtggcgggggagaaagagtgcgtcctgtaaggtgtgttcagaaacatggatctgat
gtggtgaaggttccagaatccaaatgttcacctgatacagctccgcacgctattgaaaaa
tgtaacctgcagcactgtcctgccagatggcacgcgtcagagccagggaattgttcggca
atctgcgggccaggagaagcaaaacggatcgtatcgtgtgtccgacctgaaggtggcgtg
gatgttgaagtcgatcaaagtttttgttcaaagcagattaaacctcccgattctgtgccc
tgcgtggtagacgtgtgtcccattgggtgggaatcagaccgagaggaacaacccagtcta
aagtctggtttgttaccacgctctagtcagcctcgtgtgtatgtgtggagccctgttatt
agcccgtgttcaaagacctgcggcaatggaactttgcaggtgtggttttcttgtgtggac
catcaaaccacactgggagtgcctgacttccactgtgatgcctccactaaacctcatccc
aagtctgagatatgcagcaccttaccctgccctcctgtgtggcgctctaagcaaggagtc
tgcagtgttacgtgtggaggaggggtagcaaacagggtgctgtactgtgcccgggaagca
gaaggggaggaggtggttgtggaagattcagagtgcagtaactttcccaagcccacagca
gtggtatcatgtaacactcacagctgcccagcaaggtggaaggtattcaggaccttaccc
tgctcagtctcctgtgacctaggtgtagctcagagggttgtgtcttgtgtccagtttatc
cacggcaaggagagtgtggtggcagagggaaactgccatgcagctgtcaaaccagccatc
acagtgccctgcttggtgcaagtctgcacctttaggtgggaggtgaagccgtggagccag
tgttgtgtttctctcaagtgttcagtatcctgtggctatggtatccaatccagagctgtg
tcctgcatgggcccctctaagccagagcccctcagccccctgatttgcatgcacatgccc
aagccaatcaccatccagggctgctacacgggcagctgcagagatgtgccatccacatca
gccactcctctgcattccactccaagccctaaaaacatatcacagcaccgcatacgccaa
ctatctcctagtccaacagaggccttcaccatcccagtgaccccagtggctaccacaaca
ctcactccaacccataaatcaagtgcatgtggacagctactgctggaggaatcaggcaca
gtggatttgactgatgtgacagatcgctgtgtggtatccataggccgacccttggatgag
gtcattcacattaaagtggtgtccagctccctggactgcagaaaaaaggagtatgtggca
tttttcgaccgactggcatttatgaggaagtgcgcgcatgtgggaggtactgaactgacc
accagaacaaatgtcctgctggtgcgtcaaaatctgctcacgccagggagcggggttgtg
tttacgtacagttcacagaaaaataagaagaggagccaccatcaagattgcgacattcag
ctgttctcccccagcggtgtgtttgagaatccaataacgtccagcactaaccacacctgt
cgagtgctcatcaacgcccctccctcagtgaagatcagaatccaagcactacacatagga
ttagtattcaacaccacaaactcccagtctacatacattacgatccgggacatggatgtc
ttaaagaccaacgtgtttaaaggtaaccagctgtttcagtggcactcatcaggaaatatg
gctgaggttgaatttcacggagactacctgcattctgaaggaagcttcagagctcgatat
tcatttgtgcgcctttga

DBGET integrated database retrieval system