KEGG   Oreochromis niloticus (Nile tilapia): 100696661Help
Entry
100696661         CDS       T06104                                 

Gene name
gpx8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00480  Glutathione metabolism
onl00590  Arachidonic acid metabolism
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100696661 (gpx8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100696661 (gpx8)
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100696661 (gpx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 100696661
NCBI-ProteinID: XP_003455356
AA seq 210 aa AA seqDB search
MEALGGYPTRSSNPKAKKLTVLLSMTVGVGCLFLLQTQLVKPRKPKDFYSFEVKDAKGRT
VSLEKYRGKASLVVNVASYCQQTEANYKSLQELHRELGTSHFNVLAFPCGQFGDTETGTS
RDIEAFAKSAYGVTFPFFSKIKIMGSEADPAFKFLTDSVKKIPKWNFWKFLVNPEGKVVR
FWRTDEPMESIREEVTAMVREIILKKRVEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaggctttgggaggttatcctaccaggtcctccaacccaaaagcgaaaaagttaact
gtgctgttgagcatgacggtgggtgtggggtgcttatttcttctgcagacccagctggtg
aaacccagaaaaccgaaggatttttattctttcgaggtgaaggacgcgaaggggaggacg
gtttctctggagaagtaccgaggaaaagcgtccttagttgtaaacgtggcgagttactgc
cagcagacggaggcgaactacaagtctctacaggagctccaccgggagctgggcacctct
cacttcaacgtcctggcctttccctgcggacagttcggggatacggagaccggaaccagc
cgggacatcgaggctttcgccaagtcagcctacggcgttacctttcctttcttcagcaag
atcaaaataatgggatcagaggctgaccctgctttcaaattcctcacagattctgtgaag
aaaattccaaagtggaacttctggaagtttctggtgaacccagaagggaaggtggttcga
ttttggcgaacagacgagcccatggaaagcatcagagaagaggtcacagcgatggtgcgg
gaaatcatcctaaagaaacgagtggagctatga

DBGET integrated database retrieval system