KEGG   Oreochromis niloticus (Nile tilapia): 100698635Help
Entry
100698635         CDS       T06104                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100698635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:onl04030]
    100698635
G protein-coupled receptors [BR:onl04030]
 Rhodopsin family
  Lipid
   Leukotriene
    100698635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx DUF621
Motif
Other DBs
NCBI-GeneID: 100698635
NCBI-ProteinID: XP_003437662
AA seq 334 aa AA seqDB search
MNHSVELSPSEEFDGSTAVACVILGLSFLIGAPGNLLVIWTILRHVKQRSHTVVIILHLA
VADLLVLITLPLWIYSLAHTWVFGAVLCKTLVYTVTVCMFSSIFLITVMSVERFLAICHP
FLMMRWKTKSNIKIYLVLLWLLAFLLGVPALTQNLEETDGNVQCFTRELHSDTNTIIVLC
LDTLLGFIVPFIVLSICYCLIAAQIKKMSFNSKEKSMVLIHSVVIAFTVCWLPYHVINII
DLICILSWPDTDDNCVSKSIIFIAGALVFISSSVNPVLYAFFAKNLQGSLEESRLVRLFK
EIATNTNKVRELAVQQQTDERAASTKEELLSDCV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagtcgagttgtctccttcagaggagtttgatggcagcacagcagtggcg
tgtgtgatcctcggtttgtccttcctgattggagctcctgggaacctgctggtgatctgg
accatcctgagacatgtcaagcagcgctcccatactgtggtgatcattctgcacttggct
gttgcggacctgctggttctcatcaccctgcctctgtggatctattctctggctcacact
tgggtgtttggagcggtattgtgcaagaccttagtgtacactgtgactgtgtgcatgttc
agcagcatcttcttgatcactgttatgagcgtggagcgctttcttgccatctgtcatcca
tttctgatgatgcgctggaagacaaaaagcaatataaaaatatatcttgtacttttgtgg
ctgcttgctttccttctaggagtgcctgccttaacacagaatctggaagaaactgacgga
aatgtgcaatgtttcaccagggaattacactctgacaccaacacaattatcgtcctttgc
ctagacaccttgttgggctttatagttcctttcattgttcttagtatctgctactgtcta
atagctgcacagatcaagaagatgagtttcaattcaaaagagaaatccatggttctcatc
cattctgtagtgattgctttcacagtgtgctggttgccttaccacgttatcaacattatt
gatctgatttgcatcttaagctggccagacactgatgacaactgtgtatcaaagtctatc
atcttcatagctggtgccctggttttcatcagtagttcagtaaatcctgtgttatatgcc
ttctttgcaaagaacttacaagggagtctggaagagtcccgactagtgaggctatttaag
gaaatagccactaacacaaacaaagtgagggagctggcagtgcaacagcagacagacgag
agggcagcaagtacaaaagaagagctgctatctgactgtgtgtga

DBGET integrated database retrieval system