KEGG   Oreochromis niloticus (Nile tilapia): 100698833Help
Entry
100698833         CDS       T06104                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 14
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04060  Cytokine-cytokine receptor interaction
onl04068  FoxO signaling pathway
onl04210  Apoptosis
onl04217  Necroptosis
onl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100698833
   04068 FoxO signaling pathway
    100698833
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100698833
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100698833
   04217 Necroptosis
    100698833
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100698833
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:onl04147]
    100698833
   04052 Cytokines and growth factors [BR:onl04052]
    100698833
   04090 CD molecules [BR:onl04090]
    100698833
Exosome [BR:onl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100698833
Cytokines and growth factors [BR:onl04052]
 Cytokines
  Tumor necrosis fators
   100698833
CD molecules [BR:onl04090]
 Proteins
  100698833
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF C1q
Motif
Other DBs
NCBI-GeneID: 100698833
NCBI-ProteinID: XP_003442020
Ensembl: ENSONIG00000001930
UniProt: I3J0M8
AA seq 228 aa AA seqDB search
MEKIKYPSVCVVDTHATRPPVPPRLIQVRKKTGVAQILLYMLVSVALCGMVIEACFIYGL
YQAEHTNSESISKLIGGADVTTPTKQPSYDILPSKPVAHLTDGQDLTHGKNKMAWSMNAD
PLLYEMTYEDKELKIQKEGYYYVYSKVFFSDSDTFQHRISMHTDKYPGNITLLQSRKYSS
HSKRTQSNSYLGGVFHLYQNDRIFVDVSDTAKIVRHKPYENVFGAYMI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggagaagattaaatatccctctgtgtgtgtggtggacacccatgccacacggcctccg
gtgccccccaggctgatccaggtgcgaaaaaagaccggggtggctcagatcctgctctac
atgctggtaagcgtggcgctgtgcggcatggtcatagaagcatgcttcatctatggactc
taccaggctgaacataccaactcagaatcaatctctaagctcatcggaggtgccgatgtt
acaactcccactaaacaacccagttatgatattcttccctccaaaccagttgcacatctg
acagatggacaagatttaactcatggaaaaaacaaaatggcatggagcatgaatgcagac
cctctcctctatgaaatgacctacgaagacaaagaacttaaaattcagaaagagggttat
tactatgtctattccaaggttttcttctcagacagcgacacattccagcatcgtattagc
atgcatactgacaagtatccggggaatatcaccctcctgcagtccaggaaatattcttca
cattcaaaaagaacacagtccaacagttacctgggtggagtgtttcacctttatcagaat
gatcgtatttttgtggacgtgagtgacactgcaaaaattgtacgccacaaaccctatgag
aatgtctttggtgcttatatgatataa

DBGET integrated database retrieval system