KEGG   Oreochromis niloticus (Nile tilapia): 100698904Help
Entry
100698904         CDS       T06104                                 

Definition
(RefSeq) leukotriene B4 receptor 1 isoform X1
  KO
K04296  leukotriene B4 receptor 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100698904
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:onl04030]
    100698904
G protein-coupled receptors [BR:onl04030]
 Rhodopsin family
  Lipid
   Leukotriene
    100698904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 100698904
NCBI-ProteinID: XP_003437663
Ensembl: ENSONIG00000020596
AA seq 394 aa AA seqDB search
MVSVQQPVKAVGTLAQLYGTKNTTVSTSPCSMNNTYQLSSQEEMAPSEFDGGTVVACVIL
GLSFLAGAPGNLLVIWTILRHVKKRSHTVVIILHLAVADLLVLITLPLWIYSLAHSWIFG
EVSCKAMVFMINTCMYSSVFLITLMSVERFVAVRYPFASAHWKRKQALNKVLLVLWTAAL
LFSIPVIPTQIVDNDSGEDHCLYREYTSVTQELVCLLLETLVGYIIPFSILVVCYGCLCS
RITRMTLKSKRKSTILIASVVVAFGICWTPHHIGNILSLIILATENSYKDVAEHLENVRA
TMAFVTGAMVFISSTINPILYMFAARSFRSSLRDTGIQKLFRHISSTSPGEGNREVSYVS
KRPSNQTSTSHVLSESKDQIGVLMTMCENNPSGQ
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcagtccagcaacctgtgaaggcagtagggacgttagcccaactttacgggaca
aagaacaccacagtcagcacatcgccttgcagcatgaacaacacataccagctgtcttct
caagaggaaatggccccttcagagtttgatggtgggacagtggtggcatgtgtgatcctt
ggtttgtccttcctggccggagctcctgggaacctgctggtgatctggaccatcctgaga
catgttaaaaagcgctcccacacagtggtgattattctacacctggctgttgcggacctg
cttgtcctcatcaccctgcctctgtggatctactctctggcccactcctggatatttggg
gaggtatcttgcaaagcaatggtgttcatgatcaacacgtgtatgtacagcagcgttttt
ctcatcaccctcatgagcgtggagcgttttgtggctgtgcgatatccatttgcttcagct
cactggaagaggaaacaagctctgaataaagtactgctggttctgtggactgcagcactc
ttgttcagcatacctgtcatcccaactcagattgttgacaacgattctggtgaggatcac
tgcctgtaccgtgaatatacttctgtgacccaggaactggtgtgtctcttgttagagaca
ctggttggctacataatacccttctccatccttgtggtctgctacggctgcctgtgcagc
cggattactcggatgactctcaaatccaaacgcaagtccaccatcctgatcgccagtgtc
gtggttgcatttggcatttgctggacacctcatcacataggaaatatcctctcgctgatc
atcctggcaactgaaaactcctacaaggatgtagcagaacatttggaaaatgtgagggcc
actatggcttttgttactggagccatggtctttatcagcagcacaattaaccccatcctc
tacatgtttgcagctcgctccttcaggagctccctccgtgacacaggcatccagaagctc
ttccgccacatctcgagcacctccccaggtgagggcaacagggaggtgtcctatgtgtcc
aagagacccagcaatcagaccagcacctctcatgtgctatctgagtcaaaagatcaaata
ggtgtgttgatgacaatgtgtgaaaacaatccatctgggcagtaa

DBGET integrated database retrieval system