KEGG   Oreochromis niloticus (Nile tilapia): 100699955Help
Entry
100699955         CDS       T06104                                 

Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00590  Arachidonic acid metabolism
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100699955
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100699955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100699955
NCBI-ProteinID: XP_003454212
Ensembl: ENSONIG00000010712
UniProt: I3JX72
AA seq 597 aa AA seqDB search
MKAFSIFIWVFITLLLLLLLESSSCAGDSSVVNPCCYYPCQHAGVCMRFGTDSFKCDCTR
TGFYGDNCTIPEFWTRIQLMLKPSPSVTHFILTHFPWFWYLINNSFLRDTFMRLVLTARS
DLIPSPPTYNTKYGYINWESYSNITYYTRLLPPIPEDCPLPMGAKGKPVLPDAKVFVERF
FKRQKFRPDPQGTNLMFTFMAQHFTHQFFKTNHKVQGGFTKGLGHGVDASNIYGEDLVRQ
HQLRLHKDGKLKYQLVNGEVYPPTVSEVPVHMVYPENIPADKRLAIGQEVFGILPGLTTY
ATIWLREHNRVCDILKAEHPTWDDEQLFQTARLILIGEIINIIIEEYVQHLSGYMLDLKF
DPSLLFNTRFQYNNRIALEFCHLYHWHPLMPDSIVIEGEEIPYSQFLYNTSLLMHYGVER
LVDAFSRQIAGQIGGGHNSHQVVLKVAEMVIRESRATRVQPFNEYRKRFNLKPYTSFDEL
TDNTEIARGLEEVYGDIDALEFYPGIMLEKSRPNAIFGESMVEMGAPFSLKGLLGNPICS
PEYWKPSTFGGETGFNIVKTATLKKLVCLNSKWCPYVDFHVPRNEDEAKPRKPSTEL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttagcatcttcatctgggtgttcatcaccctgctgctgctgctgctgctg
gagagttcatcatgtgctggtgactcaagtgttgtgaatccctgttgctactacccttgt
caacatgcaggagtgtgcatgcgatttggtacagacagtttcaaatgtgactgcactcgc
actggcttttatggagacaactgcactattccggagttttggaccagaattcaactcatg
ctgaagcccagtccttctgtgactcacttcatccttactcacttcccgtggttttggtac
ctgataaacaactctttcctacgagacaccttcatgagattagtgttgacagccaggagt
gaccttattccaagccctcccacctacaataccaaatatggatacattaactgggagtcc
tactctaatatcacctactacactcggctccttcctcctatacctgaagactgtcctttg
cccatgggcgctaaaggtaaacctgttcttcctgatgccaaagtcttcgttgagaggttt
ttcaagagacagaagtttaggccagatcctcagggaaccaatttgatgtttacctttatg
gctcaacacttcacgcaccagttcttcaagacaaaccataaagttcaggggggcttcacc
aagggtttggggcatggggtagacgcaagcaacatctatggagaagatctcgtgagacaa
catcaacttcggcttcataaagatggaaagctgaagtatcagctggtaaatggtgaggtg
taccctcctacagtatctgaggtcccagtgcacatggtgtatcctgaaaacatcccagca
gacaagcgtctggcaatcggtcaggaggtatttggcatcctgccgggtctaaccacgtat
gccaccatatggctgcgggaacataacagagtctgtgacatcctgaaggcagaacatccc
acctgggatgatgagcagcttttccagacagccagactcatccttattggtgagatcatc
aacattataatagaagagtatgtgcagcacctgagtggctacatgctggacttgaagttt
gacccgtccctgctcttcaatacacgtttccagtataacaatcggatcgccctggagttc
tgccacctctaccactggcaccctctgatgcccgacagcatagtcatagagggagaggaa
ataccatactctcagtttttatacaacacctccctcctgatgcattacggggtggaaagg
ctggtggatgcattctctcgacagattgcaggacagataggaggaggtcacaactctcat
caagtggtgcttaaagttgcagaaatggtcatcagagaatccagagctacacgtgtgcag
cctttcaatgaatataggaagaggtttaacctgaagccttacacatcttttgatgaatta
actgacaacactgaaatagcccgaggtttagaagaggtctacggtgacatagacgccctg
gagttttacccaggcataatgctagagaaatcccgtcctaatgccatttttggagagagc
atggtggagatgggtgctccattttccctgaaaggcctgcttggaaacccaatctgctcg
cctgaatactggaagcccagcacctttggaggagaaaccggctttaatatcgtcaagacg
gccactctgaaaaaactggtgtgtctcaacagcaaatggtgtccatacgtggacttccat
gtgccgcgcaatgaggacgaggcaaaaccgaggaaaccgtcaactgaactttga

DBGET integrated database retrieval system