KEGG   Oreochromis niloticus (Nile tilapia): 100701001Help
Entry
100701001         CDS       T06104                                 

Gene name
pigt
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100701001 (pigt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100701001
NCBI-ProteinID: XP_003444938
Ensembl: ENSONIG00000002222
AA seq 643 aa AA seqDB search
MAAHRCSCSSWLFILFSLSVFVVADIHETTPVNDHHGGADHNAQTAEQTADQPAVEGRRW
EATEVKEAATVDAAADTQGTSAPETVVPSSVPQPKDDFQEELVIRPLHSGDIYASFQFRT
LWDTDFMRENKVSHYRLFPKSLGQVISKFSVRELHISFTQGYWRTMQWGQPFIPSPPGAE
LWVWFQDSVTDVDATWKELTNVLSGIFCASLNFIDSTNTVQPSASFKPLGIGNVTDHSFL
RYATLPREIVCTENLTPWKKLLPCGSKAGLAVLLKSEKLFHSSFHSQAVHIRSVCQDWQC
KTTSWELRQTVNSVFDLHNSGQAKREWSLFKMFSRTLTEACPLASSSKLYIDITDNPQGE
QFELSPATSLLSQAVVLGDRRTFSVYDLTQETTFGSVRSLNLLIRWKSNEGEMLRPLLHA
ERYVAGYGLQTGEIHTLMYNNHPYRSFPVLLLDSVPWYLRLYIHTLSVTSKGKDNKPSYI
HYEPSKDRVKPHLLEMLIQLPPNSVTEVTVQFERALLKWTEYPPDPNHGFYVGSSVISSL
VPSTVAMDTNSTRERPLFSSFFPCKEESSYFVRIYTEPLLVNLPTPDFSMPYNVICLTCT
VVAVGYGSLYNLLTRSFQIEEPNPGLAKRIANVIRKMRGVPPL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcacaggtgcagctgctcgtcttggctgtttattctttttagtttgtccgtg
tttgttgtcgcagacattcatgaaacgacgccagttaatgaccaccacggtggggctgac
cataatgcacaaacagcggaacaaacggctgaccagcccgcggtggaggggagacggtgg
gaagcaaccgaggttaaagaagccgctacggttgatgctgcagccgacacgcagggcact
tctgcccctgaaacagtggtaccttcgtcggtaccacagcctaaagacgacttccaagaa
gagctggtcatcagacctctgcactctggagatatttatgccagcttccagttccgcacc
ctgtgggacacagacttcatgagagaaaacaaagtgtcccactaccggctctttcccaag
tctctgggccaggtcatctccaaattctcggtcagagagctgcacatctctttcacacaa
ggttactggaggaccatgcagtgggggcaaccctttataccatcgccacctggagctgag
ctctgggtctggttccaagactcagtgacagatgtcgatgctacatggaaggagctaacc
aatgttttgtcaggcatcttctgtgcatcactgaacttcattgactccaccaacactgtt
cagcccagtgcctccttcaaacccctgggaataggcaacgtgacagaccacagcttcctt
cgctatgccaccctcccacgagaaattgtttgcacagagaatttgacaccctggaagaaa
ctcttgccatgtggatccaaggctggtctcgctgtccttttgaagtcagagaaactcttc
cacagcagttttcattcccaggcagtgcacatcaggtccgtgtgtcaggactggcagtgc
aaaaccacatcctgggagctgagacagacggtgaattcagtctttgacctgcacaactct
ggacaggccaaacgagagtggtctttgttcaagatgttctctcggaccctgacagaagct
tgtccgttggcctcctccagtaaactatatatcgacatcacagacaaccctcagggggag
cagtttgagctcagcccagccacttccctgctgagccaggcagtggtgctgggagacaga
cggaccttctctgtgtacgatctgacccaagaaaccacctttggctctgtgcgctccctc
aacctgctgattcgatggaagtccaatgagggtgaaatgctgcgtcccttgctccatgct
gagcgttatgtggctggatacgggctgcagacaggagagattcacacattaatgtacaac
aaccacccatacaggtctttccctgtactgctgttggactctgtgccttggtatcttcgt
ctctacatccacacgctcagtgtgacgagcaagggaaaggacaacaagcccagctacatc
cactacgagccatctaaggaccgtgtgaagccccacctgttggagatgctgatccagctt
cctccaaactctgtgactgaggttacagtgcagtttgagagggctctgctcaaatggact
gaatacccacccgatcccaaccacggtttctatgtcggatcttcagttattagttctctt
gtgccaagcactgtcgccatggatacaaacagcactcgggaacgaccacttttcagcagc
ttttttccctgtaaagaagagtccagctactttgtccgcatctacacagagcctctgctt
gtcaatctgcccactccagacttcagcatgccttacaatgtcatctgcctaacatgcact
gtagtggctgtgggctacggctccctatacaacttactaacgcggagcttccagatcgaa
gagcccaacccaggactggccaagcggatcgctaacgtcatccgaaagatgaggggcgtc
ccgccactctga

DBGET integrated database retrieval system