KEGG   Oreochromis niloticus (Nile tilapia): 100702081Help
Entry
100702081         CDS       T06104                                 

Gene name
cnp
Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:onl04147]
    100702081 (cnp)
Enzymes [BR:onl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     100702081 (cnp)
Exosome [BR:onl04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   100702081 (cnp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_33 6PF2K AAA_16 KTI12 Zeta_toxin AAA_30 AAA_14 AAA_22 AAA NACHT Viral_helicase1 ABC_tran PhoH Torsin CPT
Motif
Other DBs
NCBI-GeneID: 100702081
NCBI-ProteinID: XP_003442201
Ensembl: ENSONIG00000001073
UniProt: I3IXM1
AA seq 638 aa AA seqDB search
MDTEKSGEVLGASETPQQAETAVEKAAVETPVESTEPEKSPAAEEATGHESQVVKEMEAL
SVTDKVAMPEEKDPTEKADADSLPGAAASQQPEESSEKKISEQQPVPENNPESLALQTPL
AESSPEPAPEKAAESVPEIKVQTLPDSAVTQQSVDTQPPGPKEKEQAESVGELQKAMDTE
AEGESGAKPKEKEEAKPEETVVSDVSSEKPAEAEMLKTEASAEVGNVRPESEPQKEEDIV
PASGSLSFAFLEQEQTKDALRISRTLVVLRGLPGSGKSFLARAIADTYKDHCAVISADDH
GVKPEKPESNVEGYKALDEAVIARCADGNASSVLIVVDDTNHTQDRLSRLGEIAEENNLV
AIFLEPKTEWNRDLGQLTKKTKRGLEEAHLAAMKGPLEEVSLPLFFGWFLLTSIQDKIKC
TSMDFLKTLDTLEAFKKHLIDFSGKAEEVDLEQYFQPTGILHCTTKFCNYGKAEGAKEYA
EKQAVKDFYGSIFDLSLSALFVTPRTFGARVSLTEEQLQLWPADADAEKQAESVPAAASM
PLGSRAHVTLGCAENVEPVQTGVDLLEILTLQQEGQQGEQVEEMELGTLTYYGTGKWLLN
LREPISAPACFSSFYGRKEPEPTKKDHEKKKKPKCVIL
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggatactgagaagagtggtgaggttttaggtgcgtcagagactccacagcaagcggag
actgcagtggaaaaagcagctgtggagacgccagtggaatccacagagcctgagaagtca
ccagctgctgaggaagcgactgggcatgaaagccaggtcgtgaaagaaatggaggcgctg
agtgtgacagacaaggtggcgatgcctgaggaaaaagatcccacagaaaaagctgatgca
gactcactgcctggtgcagcagcgtcacagcaaccagaagagtcatctgaaaagaaaatc
tctgaacagcagccagtgccagagaacaacccagaatctttggctttgcaaacgcccctg
gcagagagctcccctgaaccagcgccagagaaagcggccgaatctgttccagaaataaaa
gtgcaaacattacctgactcggccgtgacacagcagtcagtagatacacagccaccgggc
ccaaaagagaaggaacaagctgagtctgtgggagaactgcaaaaggcaatggatactgag
gctgaaggtgaatccggagctaagcctaaggagaaggaagaagccaaaccagaagagact
gtggtgtctgacgtttcctcagaaaaaccagcagaagctgaaatgctaaagactgaggct
tcagcagaagttggaaatgtgagacctgagtcggagcctcaaaaagaagaggatatcgtc
ccagcctctggctccctgtcttttgcctttttagaacaggagcagaccaaagatgccctc
cgaatctctcgtacccttgttgtccttagaggccttccagggagcggtaaaagctttttg
gcacgtgccatagccgacacctacaaagaccactgtgccgtcatcagtgctgatgaccat
ggtgttaaacctgaaaaaccagaatctaatgtagagggctacaaggcactggatgaagct
gtcattgctcgttgcgcagacggaaacgcttcctctgtgctgatagtggtagatgacacc
aaccacacccaggatcgcctatcccgcttaggagagattgctgaggagaacaatcttgtt
gctatcttcttggagccaaaaactgaatggaaccgagatcttggacagctgaccaagaag
accaagcgtggcctagaggaagcccatctggcagccatgaaaggaccccttgaagaagtg
tcccttcctcttttctttggctggttccttctgacctctatccaggacaagattaaatgc
acgtcaatggacttcctgaaaacactggacaccttggaggccttcaagaaacatttgatt
gacttttcaggaaaagctgaggaggtggaccttgagcagtactttcaaccaacaggaatt
ctccattgcactacgaaattctgtaactatgggaaagctgagggtgccaaagaatatgca
gagaaacaggctgtaaaggatttctatggttccatcttcgatctgtcacttagtgccctc
tttgtaacccctcgcacatttggtgccagagtgtctctcactgaggaacagcttcagttg
tggccagctgatgcggatgctgaaaagcaggcagagtcggtccccgcagctgcctcaatg
cctctgggaagccgcgcccatgtcactctgggctgcgcagagaatgtcgagcccgttcag
acgggcgtcgatctgctggaaatcttgaccctgcagcaggaaggccagcagggggagcaa
gttgaagagatggagctcggcacactgacctattacggtacaggaaagtggctgctcaac
ctcagagagccaattagtgcaccagcctgcttctccagcttctatgggcgcaaggagcct
gagccaaccaaaaaagaccacgagaagaaaaagaagccaaagtgtgtgatcttgtaa

DBGET integrated database retrieval system