KEGG   Oreochromis niloticus (Nile tilapia): 100702396Help
Entry
100702396         CDS       T06104                                 

Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:onl01001]
    100702396
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:onl04131]
    100702396
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:onl04812]
    100702396
   04147 Exosome [BR:onl04147]
    100702396
Enzymes [BR:onl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100702396
Protein kinases [BR:onl01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100702396
Membrane trafficking [BR:onl04131]
 Others
  Actin-binding proteins
   Others
    100702396
Cytoskeleton proteins [BR:onl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100702396
Exosome [BR:onl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100702396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase fn3_4 C1-set Ig_6 Pkinase_Tyr Ig_5 THB Ig_4
Motif
Other DBs
NCBI-GeneID: 100702396
NCBI-ProteinID: XP_025759362
AA seq 28723 aa AA seqDB search
MSTQAPTFTQPLQSVVALEGSAATFEAQISGSPVPEVSWFRDGQVLSTTTLPGIQILFSD
GRAVLRIPAVTAAHSGRFSVRATNGAGQATSTAELLVTVETAPPNFLQRLQSLTVRQGSQ
VRLDVRVTGIPTPAVKFYREGAEIQSSADFRILQDGDLYTLLIAEAFPEDSGTYSVTATN
NSGRATSTAELLVQGEEAVPAKKLKTVSTSQITASQSRVQRVETSFQASTKREIHAGEVM
ITQHLAHKTPPRVPPKPTSKSPPSYVSKVTAGRQQSPSPVRHVKGPTPTPVRPVSPSTKL
SVSPIRPVKSPIMTRKQVSTSAEVLPPWKQGDYATEASYTSMASMTAVSSTTQLHMQKHW
EQQVAATREEVAAVPTRSQEPVVPPTLIAGLKNLTVTEGESVTLECKISSHPSPVIIWFR
EDYKIESSIDFQISYEHGFARLIIREAFAEDSGRFTCTATNEAGTVSTSCYLLVKVSEEI
ESREETAVTEIAITQEKTVAAEAKLQTVTEFSAGEPAAPFFIKKPTVQKLVEGGSVVFEC
QVGGNPRPHIIWKKNGVLLTTGYRYKVAYKETGECKLEISMTFADDAGEYSIFAKNPHGE
ASASTSLLEEEEYEAHMKQHDVTYKTEVTTTVVQEPSVVMSQYELEQRRTITPMSFVSET
EFLISAFEERIIQKIELCIMRITYKELVAEDGELVVTIADEEAAQPAFDTPVKNYRIMEG
AGVTFHCKMVGNPLPKIAWYKDGQRIRPSGRYQIEVLQDGRASLRLPVVLPEDEGVYTAF
ATNMKGNAVSSGKLYVEASEAVTPQRYTPQPAVQRIRSTSPRSLSRSPGRSSSRSPRRSP
ARRFDETDEAQLERLYKPVFVMKPSSIKCSEGQTARFDLKVVGRPMPDTYWFHNGQQVIN
DNTHKIVIKEDGTQSLIIVPAMPQDSGEWTVVAQNRAGRASLSVTLTVDAQETLARPQFV
EKLKNITVKQGTLVELAVKAIGNPLPDIVWLKNSDIITPHKHPQIKIDGTKGEAKFQIPS
ASGSDSAWYTATAINKAGRDTTRCRVNVEVDFAAPQTERKLIIPRGTYKAKEIAAPELEP
LHLRYGQEQWEEGDLYDKEKQQKPQFKKKLTSIRMKCFGPAHFECRLTPIGDPTMVVEWL
HDGKPLAAANRLHMVNEFGYCSLDYEVAYARDSGVITCRATNKFGVDQTSATLIVKDEKG
LVEETQLPEGRKGAYRMDEIERVAHEGGPAGVGADEESEKTKPDIVLLPEPARVLEGDIA
RFRCRVTGYPAPKVNWYLNGQLIRKSKRYRLRYDGIYYLEIVDIKSYDSGEVRVVADNPL
GTAEHTVKLEIEQREDFRSVLRRAPEPKLAEATHEPGKIGFDIVKMDRPSEASQDREVVK
LRKTQRIVHEKTSEESEELKSKFKRRTEEGFYESISAVELKSRKRDDSYEDLLRKTKEEL
LHHMKEKEEAERKKMEEQGKVTIPTIKPERVLLSPSMEAPKILERIASKTVAPMDEVRFR
VRVVGRPEPECQWFKNGIQLEKSDRIYWYWPEDNVCELVIRDVETQDSASIMVKAINIAG
ESSSHAFLLVQAKTAVSFTQNLEDASAKEKDTMVTFECETNEPFVRVKWFKNNMEIFSGD
KYRMHSDRKVHFLSVLMIEMRDDAEYTCVISDDENTRTSARLHVEGAALELIKHMENIEV
PESYAGEFEVELSREDAEGSWLFGDKVLSPSNKYIISSRRGRHTLSVKDVRKEDQGKYTF
VCGDLKTSASLKMKLRPVTLMQPLTDLIVCEGDIAQLEVRFSQENVEGTWMKNGQAISAS
ERIHIVIDKMVHKLLVENVSTEDAALYSFVVPAQDISTSGKLSVQTIDIVVPLKDVSSIE
GTKAVLEAKISAQDISSVKWYHNDKLLTPSDRIQMVAKGAKQRLVFTRTFASDQGHYKLV
VGKVDTSCSLTVEEVHIVKHMEDKVCSESQNVTFNVEVSHPGIDSIWTFRNQQIKPGPKS
KIESKGKAYSLTVIDAMKDEEGQYMFHAGEKTSSAKLTVSGGAITRPLQDVTVAESQTAE
LECEVANANAEGKWLKEGQPIDFNENVVSEVNGAIRRLIINITRPQDVGEYTYQVANSKT
TANLRVEGVKIKKTLRNQTVTETQEAVFTLELTHPDVKGSQWIKNGVELQNSEKYEIISS
GVVQTLKVKDCNIQDESVYSFKLGKLSANARLNVEKIKIVKKIKDATSLLDGTASFEMSL
SHDNIPVRWMFKGLELTSSEKCKILSERKAHKLILKNLDSSDAGEYVAVVGHLQCSAVLT
VEALQVTKPMKSVEVPETQVATFECEVSHFNVPSTWLKNGVEIEMSDKFRIVVQGKLHQL
KIMNTSRDDSAEYTFVCGNDQVSATLTVNPVLITSMLKDLNAQERDTITFEVTVNYEGIT
YKWLKNGVEIKSSDRCQVRSRQLTHSLTIRNVHFGDGGEYKFVAGSGATTANLFVEARVI
EFTKKIKDIKITEKKKAVFECEVSEPNIQVMWMKDGQEMDMSEERYIVTAEKYVHRLVIQ
TVRMSDAGEYSVVAGSSVSKARLTVEGRDIRISEPPEREITVLEKHRATFEFEVNEEDVE
GHWLKNGVEIQFSMEDRFNYVTIRKLHRLTISETYRSDAGEYTFIAGKNRSTMQLRINIP
EPPQILRHMEPQSVEAGKPARFSVQVSGVPQPQVFWYKNSQALSAGFKCKFLHDGNEHTL
LLIEVFPEDAAVYTCEAKNEYGTATSTATLNVEVSEVVSPDSPATVAPPVIISPIASTSA
CEGAPACFQCKVRGDDVKISWFHKKKEVKQSEFFRISQFDDSCQLEISRVYPEDDGEYTC
MATNNGGTVSCSATLTLDVTHVREQAETKTELEVKVPPVFRQKITPLEINVGSHTKFECE
IEEAPDVTFKWYKSGTEIRQSEKYRIISCHTSSTLELLNPVKADSGEYTCKASNQHGTDS
CTASLIVTEMYPPVFVSKPDPMTLYVGKQAVFQCSLTGSSPMEVVWHKDNITISSERNYV
MKCEKNKYSLHIKSLELTDQGVYLCKASNSVGVATFAVELKVIDKPRFVTVIEPVSAAVN
DPLRLECHVNEDTGVAVTWTRDGKKVHQSMECKLSFEDKVAVLEIPKSKLKDSGKYVCTA
ANEAGSSSCEAVVTVQEPPAFVKKMESKLTWKQGIAARLQCTIKGSPELHIQWFWNEREL
SNGDKYKISFKTGVATVEIMNLLVTDSGRYTCEVSNNAGSESCSTLLAVKEPPCIRKDLQ
TVEAVKGAAAHLECEVTGTAPFEITWLKNKKPITSDQKYKLISQDSIARLEIQTFDTTDI
GDYQCVISNDVGKVTTKAMAKLKDPPTFSKRVESVTAVLGNTVKLQGMIKGSTPITVKWI
KDSKMLRDDDPNIKMVFENGVVSLSITTVAISHGGKYSCQAENEAGQQKCEAILTVQEPA
RIVEPAESISVTAGDSATLECTVSGSPDLKVKWFKDGKEIISGRKYKMTLKDNIATLKIL
TAEKGDTSEYKMEVANKVGKDQCTCSVTVLDRIMPPAFTKSLKRVDGNIDNPVSMDCKVS
GSQPMTVTWFKDDQEIVSGDKFQPEFKDSSAILRIMWLEKADSGVYKCRATNSAGFKETS
GTLYVKEPPAFTVKPHDQDVIPGTTVSLRTAFTGTAPLTVKWFREEKEIITGGTYFIKKD
ASSSSLELHSVKPTDTSKYTCEVSNDAGKVDCTVVLFVKEPPVFVRKPEATKLITSGDSA
GLECKVTGSPVISFKWFKDEMEINASSKYTMSLIDLMATLEIANCTVEDSGDYVCVASSE
AGSDRCTCTVIVKEPPLFLRSLEHKDVVKGSELTLECQVSGSAPFTVSFYKNSKLIRNDK
RHRITVKEDLLALQVLAVETGDVGLYQCSVENEVGRASCDCHVTLKEPPSFVRKLENLSS
LAGSEVSLICSLKGSEPISVAWLKDNHELREAENIQITYENKTALLQITNLQSSHCGKYS
CQVQNQAGSQTCSAVLTVKEPAKITEEVKSISVTQGDPATLEARFSGTKPLKVRWLKAGK
ELTSGQRYKVQSKDTSSVLKIIKTQKSDGGEYIFEVSNDVGQSSCDATLTILDQIIPPSF
TRKLKQTEGVKGSFAHLECLVSGSLPITIQWYKDEKEIQTDDKHKCTFFENVPFLEISNL
DTKDSGNYTCIATNKAGTVQCSGVLFVKESPCILEKPESINVLPGSKVQFSILFSGTPPL
TTKWFKNNKEILSSADWSVIKDNTSSTLELFFAKTTDSGDYVCQIQNDVGSASCQATLFV
KVPPKFTQIPARVSVVCPGQSKVFECQVTGTPEIDIYWFKEGSEISPTDHYKMAFVNSVA
TLEVCGAEVKHSGLYYCEARNEAGSESCSMELKVKEPPSFIRELARADVVKGSTAILECQ
VAGTGPFEITWHKDGKELKPSAKHAFSQLNDTVCLEVHKCDAVDIGEYQCTVANEVESCT
CKTTLSLKEPPTFIKTIENTAIVLGKMAEFQCIVKGSPIISVQWKKDENWILEDPKIQRT
FENNVATLRIPACEAIHSGKYTCQVVNEAGQDKCFATLTVQVPPQITEKPEVVKVTVGDP
VSLDCKVTGSPELRVKWMKDGRELKSIRQHKLIFENNISSLKIQAAQKEDEGEYVFEVVN
YISSCTCKVKLIVLEQVIGPSFIKPLVDMHEILGSFVQICCKISGSLPISVEWKKDGTKI
SSGLKHKLIQQDNSVSIEIEQLERSDAGLYSCKLTNTAGSCECSGSIAVKEPPSFVTVPE
SQTALPKATARFKGTFKGTPPFTVKWFKDDTELMTGPTCLIGLDGLSCFLELYSVGVTQS
GVYACQVSNDAGSVHCSANLTVKEPPEFLLKPPANKFVKQGESLRLECKVSGTVPLKITW
YKNDTKVTDGGNYRTSFVDSVAVLELVSTSFEDDGVYTCEAQNDAGSVSCSTTLTIKDPP
SFVKIPQPVEGLKGKDVSLYCEMSGTAPFQITWFKDRKPLMESRKFKLVSEGSSATLHVI
GIEPSDAGEYECKVSNSVGSDTCHTSIKLREPPSFVKRLSNMTVILGGEVTLVATVKGSE
PITVSWVQDKDHILRDSDNRKITYENNQVAVKIFNADATTAGKYTCQLRNDAGSVECFAN
LTVLEPAKIVDKPDALSVTAGDMAALEVKVCGTPELIPKWFKDGAELASGRKYKISFSRM
ISSLNVLSAEKVDSGEYTFEIMNEVGKDLSKINLTVLDKTIPPTFSRKLKDCTTVVGKPL
EMECKVSGSSPFTISWYHNDEEIKSGPNYEISFSDNNCTLKVLTLKLADSGAYKCKAVNK
AGTTETTAFLVVREPPTFVVPPQPVEAMPGSNVTFSAMVKGSAPLKLKWFRGTKEIVAGH
GYDFSLDDNKVLLELYNVDKSHAGEYTCQIINDAGKESYPVNLTVKEPATFSKKLKDISV
EKGKPLTLECTYTGTPMITVSWYKDGQQIFASYKYNITTTESSCILECLSTDDKEAAGRF
CCQVCNDAGKDTCEAVVSILEPPYFTESLEPMEVTAGDAVCLKCQVAGTPEIKVSWFKAD
GKVRSSPTCKLEYTKGVACLKLSKATKSDIGEYTCKAENRIGSASSSCRLNVLEAKTPPS
FPKKITSLQQTEGQPVRFECRVAGSLPIEVSWLKDGKPLSQGEEFSMLYDDNTAVLQINN
SEMRHSGEYTCVATNSVGSASCRAKLTLQEPRYPPVFDRKLSLQEVTVGDSIELECHMTG
SAPIKVTWSKDHKDIRSGGNYKISCVDNTPHLTILKADKSDTGRYFCHASNDMGKDSCSS
DITVKERKNPPVFTKKPSEHIEDMEGKLVKIEGRVSGSQPMSVSWFKDDTEIQSSDKYDI
SFKSNVAVLCIKNSQVNDSGRYSCQASNEAGKASCDVTVGISEAKKPPVFDVPLKPATVD
EGEKLILRCHVCGSSPLKIQWMKDRKELTPSSSTRISFSDGTACLEISTVSKLNAGDYLC
KATNEAGSEFCKAKVTVKEKPGAALSPAEAPAASPSKKMDNLFFIEEPKTAHVTEKGTAT
FIAKVGGDPIPSVKWMKGKWRQVTHGGRISIEQKGQEAKLEIREVTKSDSGQYRCVASNK
HGEIECSTDMHVEEKKDVAMLEGDLRAKLKKTPSKQKSPQEEKDIDIVELLRNVDPKEYE
KYARMYGITDYRGLLHAIEQLKKERAEESGRQEVDRGDRESDEDMARLVADLQKRMERTE
PVTVVKDISNQSVFINEEAVFECEIKINYPEITLSWYKGTQKLDTSDKYNITISGDRHLL
RVKNCQSSDQGNYRVVCGPHISSAKLSVMEVEVEKHLQDTMGKEGQSCTMSCQMSIPNVE
AQWFKNGKQLKMKDRYTSEVKHKVQKLLIRDLKPEDQGRYTCKYQQLESSADLWVEAEQI
HFTKRIHNIEVNERQSATFECEVSFDNAIVSWYKDTWELKESPKYNFRSEGRRHFMVIQN
VTVEDEGVYSVIVRLEPRGEAKSTAELYLSGKEIELAMVPIDMPDSSVQRPEVPTSVAIQ
ESFEFYHYEEEIEDRAVVRVAIEETVETKQVQMREEIPTKVEERPEEKPTPAVKEPSPQK
EPEARKQVEEKIPVVSVPEKDVPVPRETEEVKRPTASPPPPTEKPGVPKKDEPKPQVPAD
SKVVAPKAKPEAEPKPKPKAEPEPKPVPTPKAEPEPKPVPTPKVEPEPKPVPTPKVEPKV
KPEEIPEQEPEAKPVPVKKVVTPPSKVPEEAAKPDPSKTRRKPADTRLEPDKPKPEARKP
EPSLTKQEPKEPAVIPKPEPVVKKSEAEITAPKPVVPKPEPPVTKPEPTPAPKEPTKKEF
YFEASEEPAKKEVSSPIQPPQPPLAQPQKFETEEQAPQKKPVAVKVPVEEKITELPKAAK
KAEPAVVPPKEEPTKKEKAWKLEPKPVPEKGYQKVFDEVAVLEPEPVRLPEKISESVPER
PTEKVLKPKKGMKEIPKLEPEDLPEKVPEKPREEKVPEEAVPKRKPVKVPQKVVKEALIT
EKQTSVSTEEFKVELISKTQTEMISAEKTVHVKAPDKIPDTVSKAKPKQEVEEILPKETE
AKKTERILHTEIEQDIKIYATKKETEDKILIAAPEALSPETQAAAKTERLEKVLVKEKEL
VPEIKESLVKPATPQKESKPQAAVKDQEAAKKPEVTDNAKLKKTITPPEEKPVVETKPVM
TAEEPTKMIAEEEKPLTKKISPGTDESKGPVQAPGGVKKEGQPTEEAGRGRGRGLKPKQT
PSPGEGRGRGLRPGGKGPPPPEEPFAGFKLKAVPLKFIKKLQNIVLQEAESIGSSAVFEC
EVSPSTAVTSWMKDGSNLRESPKHKFTSDGKDRKLNIIDVQLSDTGEYTCVAKNAGKEIS
CTAKLIVEELPVKWIKELEEETSAIKGQPVYMTCELNKERDVIWKKNGEVLKKKEGKIQI
NIIGMQHAVTIQNSTEEDAGVFSCEVAGQEDVKTTTNVKVIEIVKDWIVRPLRDQHVKPK
AAATFKCELFKETPNWKWLKGENEVQPSDKIEIKKEGKELTLVIKNCQPDDVAEYALEVE
GRIYTAKLTLGEREAEILKPLVSVEVVEKEDAMFETEISEDDIPGEWKLKGEVLTRSPTC
DIQMEGTVRRLKLKNCQLDQAGEVTYTALNAITSAMLNVKERDIKVVRPLHSVEVTETET
AKFETEISEEDLHATWKLKGETLHPSANVEIKEEATRHLLILYNCKMDMAGSVDFAAANA
KSSAQLRVKARVIGLQRPLKDVTVTAGETATFECELSYEGIAVEWFLGGTKLEPSDRVVL
KAEGKVHTLTLRNVEQNEAGQIKLTAKDFQTEASLTVKEPPVEFSKPLEDQTVEEEATAT
LECEVSRENAEVRWFRDGQEIRKTKKYEMIIDGCKRALVIHDCTLDDSKTYACDAKDFKT
SCFLNVEPPHIEFTKPLHDVEVVEKESARFECEVSREDVKVRWFKDGNEIRKGKKYEIIA
QGRQHILIIHKSVFDDEAEYECDAKTSKSSGMLTVVEEEARFTKNLFNVEGTETDSVKLI
CEVSKPSADVIWYKGDKELPEGGRYEQTVDGKRRILLIKDLNMSDAGEYNCRLSPSNKTS
GNLKINELAAEFISRPQSLEVVEGEKAAFTCSVSKETYEVKWMKDDVELEAGEKYQIVTD
GKRRTLEIKDCELKDEGGYIVMIGPTRASADLTVLEKLKIITPLKDTEGKEGQEVVLNCE
VNTEGAKAKWLKNDDTIFESSKYVITQRDNVFSLRIKDVQKGDESNYSINLTNQRGEHAK
SHCSLTIREESLRIVVPPEDIDTQEKRTISFSCKVNRPNATLKWMKAGEEITFSKRIVYR
VDKDKHTLTIKDCTLADEGEYTAVAGDDKATAELIISEAPTDFTMQLKDQTITEFEDAEF
TCKLTKEKAEVKWYRNGREIREGPRYIFERDGKICTLRIKECRPDDECEYACGVEEKKSR
ARLFVEETPVEIIRPPQNVFEPPGSDVVFEVELNKDRVEVKWLRNNMTVVQGDKYQMMSE
GKVHRLQVCEIRPRDQGEYRVIAKDKDAKAKLELAAVPQIKTTDQSYVTDVGKPIIMVVP
YSAYPQAEADWLYNNLSLQKDNIYTSAEHTEYRLKNPKKVDEGSYKIIIKNKHGAGEAFI
NLNVIDVPGPVKNLQVTDTADGEISLAWEEPESDGGSKVIGYVVERRDVKRKTWTLATDH
AESPEYTVTGLQKDSKYLFRVCARNRVGSGPTVETDEAVQAKNKFDVPEAPLNVIVGNVT
KFGCTLSWEPPTSDGGSPITSYIIELRDRTSVKWSPVLVTKPDDLSAIINDVIENKEYIF
RVKAENRAGVGKPSAASQPVKIMDPIERPSPPLNLSWQDQNKSSVQLTWETPLKNGGSMI
TGYIIERCEDGSDKWLRCNARLCPDLFYKVSGLKYGTKYNYRVLAENAAGVSEPSNIIGP
LLADDPHVGPSFDLSAFKDGLEVIVPQPLTIRVPITGYPIPVAKWTFGEKELSSVDNERV
FLMTKSTFTELMVTPSVRPDKGIYTLHLENDVTSVSGEIEVNVIAAPSAPKDFKVLEVTR
QHVHLSWEAPEHDGGSPLIGYQVEKRDVSRKTWVKVATGIQDLEFTVTDVVEGKEYLFRV
TACNKCGPGEPAYIDEPVNVSSPATVPDPPENLRWRDKSASGIFLTWEPPKYDGGSGIRG
YNVERCQRGTDKWEPCGDLVPELKCQVTNLIEGQWYSYRIRALNRLGASRPCKATDEIQA
VDPKEPPEIQLDAKLLAGLTAKAGSKIELPADVTGKPEPRVKWTKADLVLKPDDRVSIDT
KPGHSTVTIAKTKRDDSSTYIIEATNSSGRATATVDVNILDKPGPPAAFDISEITNESCF
LAWNPPRDDGGSKVTNYIVERRAADSEIWHRLSSTVKQTTYKATSLIKFKDYIFRVFAEN
QFGVGPAAEHTPITAKYPFDTPGAPYKLEASDIAKDSLNLNWYEPDEDGGSPITGYWVER
YEADHDKWIRCNKLPVKDTNYRVKGLPTRKKYKFRVLAENLAGTGKPSKETDPILVKDPI
DPPWPPGKPTVKDVAKTSCFLMWTKPEHDGGARIDSYVIEMLKSGTTDWIRVAENITILE
YFLKGLMEKQEYSFRVRAVNVAGESEPSEPSDPVLCKERLNPPSAPRWLEVVNISRNSAE
LKWAAPERNGGSAITNYIVEKRDVRRKGWQTVDTTVKELKCDVKPLNEGSLYVFRVAAEN
AVGVGPFCEMEDSVLAKDTFTTPGPPYALAVSAVTKRYVDLQWEAPKNDGGRPILRYSIE
KKEKLGTRWVKCGKTSGPDCKYRVTDVIEGTEVQFQVRAENEAGSGHPSEPTEILTIEDP
TGIPSPPIELHVTGASRDFLAIAWKPPQTDGGAPVRGYHIEMCEAGTEKWMRVNSRPVKE
LKYRVEEGVTPEKEYILRVRAVNAIGESEPSDISENVFAKDSDCNPTLEFQTLDLVVVET
EKLHIPVPFRAVPLPRITWHKDGKELKADERLGFRKEYTSCHLEIDSSLHADAGVYKVTL
ENKLGSASATINVKVIGLPGPCKEIVASEITKSSCKVSWDPPDYDGGSPVLHYVLQRREA
GRRTYVNIMSGECKVSWVVKDLIPSGEYYFRVQAVNKIGGGEFIELRNPVIAEDQKHAPD
PPVDVETHNPTSSTVTLTWKAPMYDGGSKIMGYILEKQQKGEDKWERCNDFLVPVLSYTV
RGLTEGKNYTFRVRAENAAGISEPSRNTPFIKAADTIDSPKVFLSGSLQSGLSVKRGYEI
CLDANISGSPYPQITWYWNNQSIRPEPLRKRPEKPLKKKVEKKEEEKKQEKEKEEGTAEK
KEEKEGEVKEPEEKEGEVKKEEEVPEPEVEEPDYPTINERLAIDNSHKGVSSIIIRDSIR
PDHGVYMVKVENDHGIASATCEVNVLDTPGPPVNFRFEEVRKNSVICKWDPPLDDGGSEI
LNYTLEQKDNSKLEIGWSTVTAILKGCRYLVPKLIEKKEYIFRVVAENKYGAGPPCVSKP
VIAKNPFEPPEAPDKPQVDDITANSMLVTWNEPNDNGSPILGYWVERREINSSHWARVNR
NIIPVPELNVEGLIEGLTYIFRVAAENQAGPGKFSVPSEPKTAQPAILPPGPPVARVAAT
TDHSIEVEWDPPADNGGGEILGYHVDKAMAGTKDWSRSTERPWKTRNFTVYGVREGAKYM
VRVIACNAAGEGTPGFTESVFVRNPAEIPVIELDLSVKNGVVIRAGENLLIPATVTGKPY
PAITWTKDDGKPDKDRVEILTEDNNSIFSVKNVQRKDCGKYQISACNPSGTKSAWTRVEV
MDVPGPVTDLKPVVVTRKMIFLNWDDPEDDGGSDLTGFLVERRDPKMHTWRQPVETTSSK
CECVGIMEGQEYLFRVIAKNKYGLGPPVELGPIKAVDPQGPPSYPEKFHYTERTKNSITF
AWKPPRNDGGSPIIGYFVEKKRQDQQAFEPCNTEICPNMTMTVEGLDDAWMYEFRIKCAN
LIGESEPSIPLTVVIQDDEVSPEIHMLKQFKGDTITVKKGESIEIPADVLGLPIPKIEWS
KDDVVIEKPTETLLMETNVTGRMNCKTMLSIPAANRRDRGSYTVAASNNMGSAKHTVYVM
VLDRPTPPRNVTVSNIRGESCYLNWDAPLDNGGSELTNYIIEKKEVVTEVPEVEEGQEAP
PEPQWEEVTNSIIERKYGVWNLENKKTYLFRVRAENRYGKSDPCTTEEVHIIDPFGLPGP
PEKPTIAEYCKTSMTLTWEPPRDNGGSTIIGYWLEKREKGTAYWAKVNKMPITKRGMKGW
EYQVTRLFEGTEYEFRVAACNSAGTGPFSGPSDSAFAVDPLTPPSMPAAPEVADKTKHNV
TLSWKPPESDGGSPIKGYIIQIQDEGTSEWVRVNDPETLHPTTEFTVPSLRELKRYRFRI
IAVNDIGESDPSPRTSEVLIEDVQLAPSITLDVMADDLVSIRAGDPIRIPTTIKGRPTPK
VTWDFDGKAKTHKKNKLHTLPVDSEVESTDTTSVVTIPVSLRSHSGRYTITAKNKSGQKH
LNIRVIVLDVPGPPKDLKITDITRSTMRLIWKLPDTDGGERIKSYFIEKKSVTDKAWTKV
NVACASQAYVVPGLLEGQDYLFRVRAENRLGFGPFTVTTEPARARDPIYPPDPPTKLKVN
LVTKNTVTLSWEAPKNNGGSPVKHYIIERLSWDTTSKEKETWKQCNKRDVEELTFVVEDL
KEGGEYEFRVKAVNAAGPSRPSATIGPMVIKDQTCPPTIELREAMEGEEGCDISIVAKVS
GCPFPSLVWHKASLDKPEEKSAIQYDQHINKLVTQDKCTLLIQQASRHDSSLYSLTATNS
LGTVCKDIKLLVFGPPGPPVGPIKFTEVFAERIGLAWNPPIDDGGSKITNYVVEKREENR
KSWVHVSNDPKECTYVVTRLTENHEYEFRVMAQNKFGVGPPLVSDPEKARNLFTVPGQCE
KPTVTEVCLESMTVNWEEPKYDGGSPITGYIIEKKETTAKRWIRVNREPIRALPLGNNWD
VTGLLEGAVYQFRVIAVNAAGCGLPSIPSDPILCRDPIKPPGPPTPKVTDWTKSTVELEW
IPPLVDGGSKVTGYIVEFKEVNKEEEEKKAQRRLLLSVAEEEKETETEEAWVKAKDTEIR
GTKFVVAGLKEGGLYRFRVRAVNAAGVGDPGLVSELIEVKDRTIPPEMDLDASVKEKIVV
HAGGTIRIIAYVSGKPTPQITWCRDDSEVPKEAVVETTGISNSLVIKNCRRQHQGIYTLS
AKNEGGERKKAVIVEVLDVPGPVGLPFTGENLTNDSCKLTWYSPEDDGGSAITNYIIEKR
ESDRMGWTSVSYTVTRNNAVVQGLIDGKGYFFRIAAENIIGMGPFVETDKMVLIKDPISV
PERPEDLIITAITKDSISVTWRPPKYDGGADVISYVLESRMIGHDNFVRVGREDKLMDRR
FTLTGLKEGSSHEFRVSAVNQVGQGKPSFATKPVQCKDELEPPTLDLDFREKLMVKVGDN
CMLSGRYSGKPAPAITWTKNDEDLKADEDISLHSTTHHLSLNISKAKREHSGRYCVSIEN
AAGTRSGICTITVVDRPQPPEGPVEFNEVYRNYMVISWKPPLDDGGCAVSNYIIEKRDTN
RDLWMPVTSSCTRTTCRVPKLIEGREYIIRIMAQNIYGISDPLLSAETKARDIFKTPDAP
KQPLVKEVYHDSALISWEPPADGGKPITGYIVERKETMANRWVRCNTERIHPKVEYWVTD
LLKGCEYEFRVSAENEVGAGDPSPPSKPVFAKDPIVKPSPPVNLKAIDFTKESVTLSWEP
PTDTGRGKIFGYLLEFQAAGKEEWHKVNQTPDSCKETKFKVINLEDGVLYRFRVMAVNAA
GESNPANITEPIRVQDRLEPPELILDAGMTREIKAMAGTHIALIAGIKGVPFPTVTWKKN
DAEVPPRADIETNQTGTKLEMRFCHRGDCGDYTLTVENPAGTKTVTCTVLVLDKPGPVQH
LRVSDVRSDSAYLSWKDPEDNGGTRITNFVVEKKDTASTQWVPVCSTSKKRSMMLKHLME
GTSYSFRVAAENQFGRSEYVETPKAIKAMNPLFPPGPPKDLHHVDVDKTEVWLAWNWPDR
NGGSEITGFLVEYQEEGEKEWYEWKTVSIPESHVTGLEEGKTYRFRVRAENAIGLSRPDT
TVPILCQEKLVPPIVEVDVKLTEGIIVKAGTTIRLPAIMRGIPVPTAKWSIEGEEITSQG
NIKIDTDNFSTILSINECTRNHTGTYLLTVSNPAGTKTVALNVTVLDVPAAPIGPVNILE
VMPDSMTIEWRPPKDDGGTPITNYIVEKRESNKETWGGVSSGSLATKLRITRLQKGVEYV
VRIRAENKMGIGAPLESKPTVAEHSFMPPSAPGKPQSYDTSEDAVTLGWTMPLTDGGSQI
TGYIIERRHKGGKWIRVNKTPCKDLRYRVLGLYEGSEYEFRVFAENIAGYSGPSPISDPC
KPCRPITVPSPPVNPKVKDYSRATADLVWTKPTKDGGSPILGYTVEMKKASAEEWKKVNL
DDLIKQCAYRVKALEEGVTYRFRVFATNMIGDGEPREIPESVTAQDILIPPEIEMEATCR
DCVTVRVGHNINIIGYIKARPDPEVFWSKEETILENSKRVTILQNLPLVHLKIKEATRND
HGKYILKASNEGGEASRTITVNVLDRPSHCQNLNVTYVTKDSCMINWESPKDNGGSEITN
YIVECREPSISMWSMISSHCTNRKIKAKLMEGHEYLFRVCAENKIGPGPSVETKTPTLAI
DPIDKPGEPENFRAIDIGKNYVNLRWRKPDYDGGSPHLSYNLECKTKDAEQWEKLNTTTL
TDTFFLADKCVENQTYTFRVQTVSEGGESAWVKLADILVREEIQKPVIDLKLAGTLTVKA
GESVRMEAALRGKPQPEVKWMKDKATGDNPRISYETGPDYSKFLMTKSKRSDTGKYIITA
TNSAGTFTAYANVNVLDIPGPVRDLRVTGIGADKCRVVWDAPEDDGGCEVDSYILEKCET
RRMVWSTYSASVVTPYCNVSRLVEGNEYIFRVRAENKMGTGPAMESKPVTVKTQFNKPGP
PEAPEVTKVSKDEMTVVWAPPENDGGKSITGYILERKEKRAVRWVPCTKSPISERRMKVT
NLIPNHEYQFRVRAENDVGLGDPSKPCRPVAAKDPIEPPGPPAALKVADSTKTSITLSWS
KPVYDGGAPIIGYSLDLRLKSEADPENPTVGWKRIDTHGPLVLTEFTIGQLDEKQEYEFK
VSAQNQVGWGRHAYLKEAVSPKEILEAPEIELDASLRKGLSVRAGCPIRLFAVIRGRPAP
KVTWKRLGVDNVVRRGHVDQVDTMSFLVIPESTREDSGKYSLTLSNSAGEKAIFVRVKVL
DTPGPVGSLDATDITKTTAQLSWLPPENDGGSPILNYVVEKREVDRKTWTKCIEDLKKTS
FKVTNLTPGIEYYFRVMACNKYGIGVPQDSPRSYLAVDPISEPDPPKKMDVLEITKNSAT
LGWLKPLRDGGAKINGYVVDYQEEGAPEDKWTPYSVVKDLTIVVVGLKEGKKYKFRVAAR
NSVGVSLAREAEGMFEVKEQLMAPKIIMPDIVTVRAGSKMTIEAIVAGKPAPVCKWKQGN
EDVLTSDRLSIVKTLTTTTLIIKNVTRKDSGYYSLSAENSTAKINQILKVIVMDIPGPPE
APLEITELDIDACTLLWNSPQEDGGSNITNYIVEKCDVSQGDWVTISTSCTKTSFRMTKL
TPGKEYSFRVRAENRFGVSEPTYSERMIARYPFDPPSEPRNLQINKVNKDFVILSWERPS
TDGGSPITGYCIEKKERNSLLWVKANETLVKATQYTCTGLIEGLEYSFRVSAQNQAGQGK
PCKQTDFITARTAVDPPGKPEPMDVTKNTVSLVWGRPKHDGGSKLIGYYVEYTKLPEEKW
TRCNANCMNIQTENYVVTNLEEGQQYQFRVIAKTAINISLPSELSDPIPVIAENVAPRVE
VGVNMKNLIVVKAGENVFLDAEVFGKPLPKVSWKKDGVPLVLAEGMKMSQKKHVHLLELY
SVTRKETGDYTITAENVNGTKYATIKVKVLDKPGPPASVKITKVFADRVKLRWEPPLADG
GSEITNYIIEKRETSRANWALVTSNIHGHITDCSVEKLIEGHEYQFRVSAENQYGVGDPI
MTDGVTVKNPYDVPGPCEPPVITNITKNSMTVSWKAPANDGKSPILGYMLEKREATELSW
AKVNRRPVIDRTIKATQLTEGSEYEFRVIAINKAGLGKPSDASNGALAVDPVYPPGPPAF
PKVVDSTKTSISLSWTKPAYDGGCEIIGYLVECKRVDAESWTRCNVPKKLQATKFLLTGL
MDNTEYQFRVTAVNKIGYSEPSEVPGNYMPKDILIAPEAELDADLRKALVLRAGVTMRLY
VPLRGRPAPKVTWTKVDANLKERQGLLIKTSDWDTLLMIEDVNRYDSGKYVLSLENSSGS
KSYTIVVKVLDSPGPPLNLTVKETSRTHACITWDAPLIDGGSPVKNYIVEKRLAERKAWT
CVSADCPKISFRITNLEAGQAYCFRVLAENAYGIGEGCETPGSIRASEQPGPVTDFKAQK
TTKNSITLSWKKPINDGGSYITAYILEQGEGEEKWKQIVKGKNTSHTIGELTEGKEYSFR
VKALNESGEGPPTELTAVAKDQFVLPNCNLSNLHDGCCVVKEGSTTRINIPITGVPNPTA
TWKKGDMGLGDTGRMCVEASQGITTLLIRDCQRGDADTYTINVRNSAGSKDCKFQLKVVG
KPGICTGPITFDEITADAITLEWGPPKDDGGAEVSNYIVEKRRTTDNKWATVASAIQKTT
MRVIRLHEGIEYIFRVFAENKYGVGEHLRSDPVVAQHPFNVPGAPAPPEIVSIRHESAIL
TWVDPKDTGGAPVTGYHIEYKEKNSLMWKRASKTPLRVKECRVTGLTEGLEYEFRVMAMN
MAGLGKASKVTEAVVALDPIDPPGKPEVISITRSTVTLMWTAPKYDGGYKLTGYIIEKLE
ASGKAWMKANHVNIQGCAFTVTDLTEGSQYEFRVRARNAAGAISIPSEPTPLLTCKDEYE
PPTITIDPEMKDGIAIRAGDTIVISASKIVGKPPPTAAWSKGGRELKTSDIVTITSTPTS
STLAIKYASRKNTGEYTITASNPFGIKEEHVKVKVLDVPGPPGPIEASNISAEKCTLTWL
PPEEDGGSSIKSYILEKRETSRLQWTKLAENVVDCRHVVSKLIKGNEYIFRVSAVNQYGT
GDSTQSGPVKMVDSFSPPGPPSTPDIDNVSRNAVTISWKRPVRDGGSDIRGYCVERKERK
GLRWVRACKRTIPDLRFKVQGLSEGVEYEFRVTAENKAGFGEPSEPSRPVMTKDIVYPPG
PPSNPRITETTKTSATFTWGRPHYDGGLEVEGYIVEYKKEGHDDWETETQYPLKASEYVI
GKLQKGGKYHFRVSAVNSEGIGEPAEVEKVTELVDQEMLPDFELDAELRRTLVVRVRASI
RMFVPIKGRPVPEVTWSKDDTNLKTRAHIDTTESYTLLVIPDCTRYDAGKYHLCLENVAG
KKTGFVNVKVLDTPGPPVNLKPREIAKNSITLQWEIPIIDGGSKIRNYIIEKRAATKKAY
TVLSTTWQKCSFKIPDLEEGAYYYFRVSAENDLGVGEPAETPEPIRVSQAPSAPENLYVT
DVTSDSASLAWTKPLHDGGSLITGYVIEAQKKDTDQWVHVATIKALDYTVTDLIEGAEYT
FRIMAVNASGRSDPRESRPAVIKEQTSAPSFDLRGVYQKTIIAKAGDRLKVEIPVLGKPR
PVVSWKKGDTVVKETQRLNIETTLTSTILNINEIKRTDGGQYSMTGKNMLGTMTETITIL
VHDIPGPPTGPIKLEEISCDYVLMSWDPPENDGGVPINNYIVEMRETTGTSWVELAATVI
RTTFKAARLTTGTQYQFRIKAQNRYGIGPSIISEPVVAVYPFDVPSQPGTPVVTSFNKDA
MTLSWNEPSSDGGSAILGYHVERKEKNSILWQRISKALVVGNLFKSTGLIDGIAYEHRVI
AENMAGLSKASKPSEPMYALDPVDPPGRPVALNITRHEVTLSWTKPEGDGGFSITGYTVE
RREMPNGRWLKANFNNILETIYTVSGLTEDATYEFRVFARNSAGAVSAPSQSSEAILCRD
DIEEPRLDVDASYSSTVVVMAGEVFKLEASVTGRPIPSLVWTKEGKELEDTAKIEIKTSE
FHTTLTNKDSLRRDGGAFTLIASNPGGFAKFIYNVKVLDRPGPPNSLTVTDVTAEKCVLN
WLHPTHDGGAKIEYFIIQRRETSRLAWTNVATDLQANRFKVTKLLKGNEYIFRVMAVNKY
GVGEPVESEPVICANPYVPSDPPQQPEVTIITKDSMVVCWDRPEHDGGSRINTYIIERRD
KTGLRWVKCNKRTVTDLRFKVSGLTPGHEYEFRVLAENNAGLSQPSPSSPFYKAIDTIFQ
PGPPGNPRVLDTTKSSITLAWNKPVYDGGSEITGYIVETCLPEEDEWTIHTPKNGWTATS
FTITNLRENQEYKINISATNCEGVGEPAAVPGTPKAEDRLVPPEIELGAELRKVVCIRAC
STLRLFVPIKGRPAPEIKWSREHGESLDKANIEITSSFTTLQVENVDRFDGGKYIVTVEN
ASGSKTAFVNVRVLDSPGAPQNLIVREVTRDSVSLAWDAPVIDGGSRVRNYIVEKRESTR
KAYSTVCASCHKSSWKVGDLEEGKMYFFRILAENEYGIGLPVETLEPIKASERPLPPGKV
SLREVTSKSVTLSWEKPDHDGGSRITGYIVEMQGKGSEKWTQVMVVKSNEAHVTGLTQGE
EYTFRISAVNEKGASDPRSLNVPVVAKDLVISPTFKLLFSTFSVLAGDDLKIDVPYAAHP
KATATWLKDGVALKETTRVNADTTDKNLLLVIKEACRDDVGTYTVKLTNTAGEASTDISV
IVLDKPGPPTGPIKLDEVTADSVILSWDPPQYDGGCAINNYIVEKRDTSTTNWQIVSATV
ARTTIKAARLKTGSEYQFRIAAENRYGKSSALLSDTIVAQYPFEVPSSPRSVTVQSTTKE
SMVVVWEKPSNDGGSKILGYHLELKERNNILWVKQNKQLVPETRFKVIGLEEGIEYEFRV
YAENIVGLSKASKVSEIQVARDPCDRPGKPEAVIVTRNQVTLRWTKPQYDGGIKITGYII
EKKEGAGRWMKASFTNITETEFVVTGLIENQIYEFRVIAKNAAGVFSQPSDSTGAITAKD
EVDPPKIDLEAKYSQAVVVNAGETFKLEATVYGKPVPTIHWLKEGQEITEAARLELKNTD
FTACLVVKEAIRVDGGQYILLVKNVGGEKSVNINVKVLDRPGAPEGPISIYGVTNEKCSI
SWKPPLQDGGSDVSHYTVERRETSRLVWTVVEPKVQTLNLKITKLLPGNEYIFRVIPVNK
YGVGEPLESEPMVARNPFVTPNPPTNVEVSTITKDSMVVTWERPTNDGGSPIQGYIVEKR
DKDGVRWTRCNKRNISELRFRVTGLLENHSYEFRVAAENAAGVGMPSAPTVYYKALDPVF
KPGPPNNPKVVDTSRSTVSLTWGKPIYDGGCEVQSYIVEACNGASDEWFMCTPPTGIMDT
KYTVKKLLEKHEYQFRVCAINKVGVGEHADVPGKILLEEKLEAPDLDLDADMRKMINIRA
ASTLRLFVPVRGRPAPEVKWGKADGEIKETAQIDNTGSYASLVIENVDRFDSGKYTLTAE
NASGVKSVFISVRVLDSPSPPTNFVVKEITKNSVTLTWEPPHLDGGSKIKYYIVEKREST
RKVYSPITTCNKMSWKVEPLPEGGIFFFRVLAENEYGVGLPAKTIEPVKISEKPQPPGKV
SVVDVTHSTVTLTWEKPLHDGGSRITHYEVELAPKDSETWSICASVKALETLVTNLLKGE
EYQFRVVAVNDKGKSDPRQLAHSVIAKDLVIEPAVRPKASSYSVQVGYDLKIDVPVAGHP
KPIITWTKDGVALKQTTRVNVTDSAQTTTLTIKDATREDGGMYTISVSNDLGSKNATVEV
ITLDKPGPPTGPVKLEDISAESITLSWEPPTYTGGCPISNYVVEKRDTTTTNWSVVSATV
ARTTLKVSNLKTGTEYQFRIYAENRYGKSYAIDSQPVVAQYPFQEPGPPGTPFVSSYTKD
YMVVEWHKPPSDGGSAILGYHLERKERNSILWTKINKMLIQDCRFKSTPLEEGIEYEYRV
YAENIVGIGECSKVSEVYVARDPCDPPSRPEAVIVTRHSVKLKWNPPEYDGGSLVTGYLV
EKRDLPEGKWMKASFTNIIEHEFTVTGLTEDSKYDFRVIAKNAAGAVSKPSESTGSITAK
DEVVPPKSETDPMYNQTIVINAGETFNLEASVEGKPIPTAQWFKGNLEVENSARVEIRNT
DFKALLVVKDAIRVDGGQYTLVLTNVAGSKTIPFSVKVLDRPGPSEGPLTISNVTEEKCS
LSWLPPRHDGGASISHYIIQKRETSRLAWTVVCSDCKATMFKVTKLLKGNEYIFRVMAVN
KYGTGEPLESAPVIMRNPFVPPGAPQDLEITNITRDSMTVCWSRPETSGGSDIVGYIVEK
RDRAGVRWTKCNKRRVTDLRFRVTGLTEDHEYEFRISAENAAGVGQPSPSTPYLKACDPT
FEPGCPTNVHVVDTTRDSISLAWHRPIYDGGCEIQGYAVEITKADEEEWAICTPPCGVNA
TKFTIKKLIEHQEYKVRICAINKVGVGEPTEIQGVVKPMDKIDPPEVILDSELRKGIVVR
AGGSMRVCIPFKGRPTPEINWAKEDGELPSKVQIETGEDYTQLSIEICDKYDAGKYVLNL
ENSAGTKSAFVSVKVLDTPGAPLNLTVTDIKRESVTLTWEPPLIDGGARIKNYLVEKRES
TRKVYSNVDNKCTKTSYRITGLTEGTIYYFRVLAENEFGVGQPAETEESVKTSEPPLPVG
KVTLTEVTKTTASLSWEKPDYDGGSRIIGYYIEMQPVGSEEWVVAATCKTCEGTVTGLSA
GHEYLFRILAFNEKGKSDPRPLAAPVTAKDITIEPKFKIQFNTYSLQHGEDLKIEIPVIG
RPVPKVEWKKDGQALKETTRINVSSTLSCTKLYIKDANKEDSGKYTVTATSSIGTATEEI
TVIILDKPGPPTGPVKIEEVSSNYITLSWEPPEYTGGCPINNYIVEKRDTTTTAWQIVSA
TIARTTIKVTKLKTGVEYQFRVSAENRYGKSSAIVSPAVIAQYPFNEPAAPGTPVISSVT
KDSMVVEWKPPTNNGGSPILGYHLERKEKNSLLWTKLNKLLIPDTRFKTTELEEGIEYEF
RVYAENIAGLSPASKLSESTVARDPCDPPGTPEPIEITRNHVTLQWTKPQYDGGSAITGY
VIERRKHPDTRWMKASFTNIIDTQFTLTALTEDCVYEFRVIARNAAGILSKPSQSTGEIT
AKDEIEAPAATMDSKFKDLTIVHAGETFVIDADYTGKPLPEVIWLKDGKEIDKATPRMEI
KTTLTRTILTVKDCIRVDGGHFVLKLINVGGVKMIPVNVKVLDRPGPPDGPLEVKGVTAE
KCYLHWNHPSHDGGAGISHYIIEKRETSRLSWTVVEPKIQAISYKITKLLPGNEYIFRVT
AVNKYGVGEPLESEAVVARNPFTTPSAPSTPEVGAITKDSMVLSWERPNDNGGAEIEGYV
LEKRDKDGIRWTKCNKKRLNDLRFRCTGLTEGHSYEFRVSAENAAGVGKPSAPTPYIKAC
DATYPPGPPNNPKVTDHSSTTVSLSWSRPIYDGGAQITGYIIEMKEATDDEWIICTPHTG
IQATNYTVKKLKENVEYNFRISAVNCEGVGEHVDLPCSVIAAEKLEAPEIELDCDLRKMV
NVRASATLRLFVTTRGKPEPEVRWSKADGTLNERAQIEVTSSYTMLVIENVDRFDTGKYV
LTLENLSGSKSAFINVRVLDSPSAPTNLEVKDVKRNSVSLSWEPPLIDGGAKISHYIVEK
REQKRMAFTSVCTNCVRNSYIISDLQEGGRYYFRVLAVNELGVGLPASTDQVKVSEPPLP
PGKIVVVDITRHAVTLSWEKPDHDGGSKITNYIVEMQPKGDDKWTMCSEVKALEATIDGL
TTGEEYSFRVTAVNDKGRSDAKPLATPVVVRDITMEPIINLLFTTYSVKAGDDLKIDVPF
RGRPQPEVCWKKDGHMLKQTTRVNVLNSKTSSKIVIKDATKEDVGKYVITLTNSVGTKSA
EISVIILDKPGPPSNIKVDEVSADFISLSWDPPTYDGGCQINNYVVEKRDTTTTTWQIVS
ATVARTSIKVSRLTQGTEYQFRIAAENRYGKSPAIDSAPVVAQYPFEPPGPPTKLHVVHA
TKTGMLVVWGKPASDGGSPVIGYHIESKDQSSILWTKVNRGLVTENQFKMTGMEEGLLYQ
FRVYAENIAGIGPCTRASDPVAARDPCEAPHNLRVTNITRNSVSLYWERPEYVGSAKITG
YIVERQELPNGRWLKCNFTNIQDTYFDVTGLTEDVRYDFRVIAKNSAEQLSAPSESTGPV
TVKDDVDPPTIILEDKFRQLVVIKAGEIIRVDAEITGRPLPVVSWSKDGKEIEAKARCEI
TSTNFTTTLIVKDAIRRDSGQYVLTLHNVAGTRSVAINCKVLDRPGPASGPLTVSGLTAE
KCTLSWGPPQENGGAEIMHYIVEKRETSRLAWTLVYGDMKATTCKVTKLLKGNEYIFRVR
GVNKYGDGESLESEPTKATDPFTVPSAPTNVQVTSVTSEAMTICWERPVSDGGSSIAGYV
IEKREKTGLRWCRVNKKPVYDLRVKASHLREGCEYEYRVFAENAAGLSAPSTPCPLTRAE
DPQFLPSPPAKPRIIDSTKTTVTLSWNKPLFDGGAPVTGYRVEYRRTLDDEWIVGVQNTK
NTEFTVVGLSPGAEYVFVVKSINKIGVSEPSPESDKQVAKEREEEPTFDVSNEMRKTLIV
KDGSSFTMKVPFKGKPIPSVTWAKADVDLRVRAVIDTTDTFTSITLEKATRNDSGKYTVT
LSNIAGTSSLTLTVRVLDSPGPPSHIEVKEVTKTSATITWDTPEIEGGGPVKNYLIDYRE
ASKKGWTRLTDTCHRLTYKVADLQEGGVYYFRVTGENEYGIGVPAETKEGTKITEKPSPP
PKLGVTDVTKESVSLAWAKPEHDGGSRITSYLVEALENGQEKWVKCGTTKSIHFTVSGLR
ENAEYFFRVRAENYAGFSDAKEMTTPVVVKDQLESPEINMKDFPHNTVYVRAGSTLKCEI
PLTGRPLPKVTLSKDNVLLKSTMRFNSEVTPDSIKITLRESIAGDSGRYDIIASNSSGTT
KSFVNIVVLDRPSVPLGPVELYDVTEDSVSLKWLPPAYDGGSPITNYIIQKRETTTANWM
DVSSAVARCTMKIMKLTTGLEYQFRIRAENRYGISEHIDSPAVTVSLPYTIPDAPSTPEI
TAVTRESITVAWKEPKSDGGSHVFGYHLQMKDKNSILWQRVNKTVIRATHFKVTNINAGL
IYEFKVAAENSAGISAFSKVSDAVLAIDACEPPLYLRITDITKNSISLAWQKPEYDGGSP
ITGYMIEKREGVSSKWSKANLTNITDTRFIVTGLTQDETYEFRVMAKNAVGSVSNPSITV
GPATCVDTYGAPEIEIPQEYLNEVKHKAGSNVELKFNIRAKPAPSIEWFKDGRELEPTSQ
LSFKHTFESTSVFLKETTRLNSGTYEVKVKNSLGSSCAIVRLLIQDKPGPPAGEIQFKKV
TADNITIMWSPPADEGGAMVTHYIVEKRETSRVMWSIVSEKLVDCIVNVPRLIKGNEYIF
RVRGVNKYGIGEPLESEPIIAKNAFVPPSEPSKPKVTMITKSTMTVIWERPALDGGSDID
GYYLEKREKRSLQWFKVVKGTIRDTRQKVANLVENNEYQYRVCAVNKAGAGNYSEPSELY
KAYDPIDLPGEPTKLRVIDSTKTSITLGWEKPVYDGGSEITHYILEQMNTEDKEWVISNP
QVKTCEYVVSHLKPGIYYFFRVSAVNCKGKGEDIKMYQPVQAKDILEEADLDLDVAMTTQ
YTAKAGRDVEVFIPLKGRPTPNVTWRRGDRNMAGDNRYTITSTERATTLLIPKVTRDDCG
KYVLEIENGVGEPKIVTVSLKVLDSPSTCQKLMIKNVTRGKLTLSWEPPLIDGGSPVTNY
IVEKKASTMKAYQVITDECLNTSYKVSGLEEDIAYFFRVSAQNEFGVGDPCETTDAVRAT
ETPGAVKDLIMVDSTKNSVTLQWSRPDHDGGSHITDYIIEKRAQDEVKWTLAAKCKRCSC
EVTGLKENTILDFRVFAKNEKGNSDFSQIGPITVMDLIIPPEANLNDYPNGELAVRIGQN
IHIELPFKGKPRPTISWLKDNFPLKESEKIRFRTTDNKTSVTVRGVKKEHAGQYTLVLDN
RVIKNYFDINVITLGPPSVPTGPIRFDEIKAQTIIISWDEPKEDGGGEITCYSVEKRETS
QANWKMVCSSVVRTTFKIPNLVKGTQYQFRVHAENKYGVSEPLISSDVVAQHQYKPPGPP
GKPVAYNITSDGMSIKWDAPDFDGGSPVLGYHVEKKDRNSLLWQKVNSTTISNREYRIIG
LVEGLEYSFRVYAENNAGLSPCSEQSKHALAISPVDPPGTPVCIDVTRDSVTLQWDIPKR
DGGSKIVAYSVERRQGRGKWLRCNFTDISETQFTVTGLSPGDRFEFRVIARNAVGTVSPP
SNSSGYIMTKDESIVPEIEWSPDQVLTLRAGDNVSLSCKITGRPVPQVLWYKDGKEIDKR
TMIDIEINTGIGTSSLFIRDSNRNHRGIYTVEAKNSSGTKKADVNVRVQDTPGPVEGPIR
FTGITAEKCTVWWSPPENDGCAAITHYVVEKRETSRITWALVTSKCEACSYNATNLIKGN
EYQFRISAVNKFGVGKPLDSDPIIAKMQYTVPDAPGTPDATHITGDSITLCWTRPRSDGG
NEIKYYILERREKKSLRWVKVSSKRPITELRHRVTKLTEGNEYEFRVMAENGAGVGPASS
TSRLFRCREPTSAPSAPTVIKVIDSTKSSVTLEWTKPVFDGGMEIIGYNIDMCKASLEEW
HRVNRQICIHTRYTVTGLVPGELYKFRVSAVNGSGEGEASVMPNPVQSLDRLTSPEIDLG
PDFKQTHIVKNGGTVTLHIAFRGKPAPLATWSKLDSELPIMADINTTDSFSTLTIENCTR
YEAGKYTLSLENNSGRKSITFTVKVLDTPGPPGAITFKDITRGALTVMWDAPANDGGSRI
HHYIVDKREASRLAWQEVSTKCSRQMIRVTGLEIGVPYLFRVIAVNHYGQGEPKEMTEPI
IATEEPAPPKRLDVVDTTNSTASLVWLKPEHDGGSRIRGYIVEFRAKGTEHWVVSGETKS
QKMVVEGLIENTEYDFRVKAKNDAGISEPQGTFSSVVIKEPCIEPTADLSSITNQLITCK
TSNTFTIDVPISGRPAPKVTWKLEEMKLKETDRVSIKTSKERTILVVKDSKRSDSGKYYL
TLENAAGVKTFTVTVVIVGRPSPPTGPVEISGISSESCTLSWSEPADDGGTDISNYIVEK
RESGSASWQVVNSSVKRTTIKVTHLTKYMEYTFRVCAENKFGVSKSVESAPVVIEHPFVP
PSPPTRPDVIFISANAISIKWDVPYADGGSKVTGYWIEKKERNTILWVRENKLPCLDCQY
KVSNLIEGLEYQFRVYAMNLAGLSKASEASRPVVALNPVDPPGKPEVTDITRSSVSLCWT
VPFNDGGSKIIGYVVERKVYSTDEWDDNRWLKCNYTTITENYFTITNLGEGETYEYRVAA
KNAAGVQSVPSETTGPVTCKDEYSPPKAELDSKLIGEIVTVTAGSDLVLDGAVGGKPEPT
VYWSKGDKILELGEKYSLTYTATRAMAVIKSCDRYDTGRYILTVKNASGIKTAAVSVKVL
DTPGAPADRIVISRVTEEKCTVSWKIPLEDGGDPVTHYIVERRETSRLNWVVMETECKTL
SCVSTRLIKNNEYIFRVRGVNKYGAGVPLESDPIIARNAYTIPSQPGTPEATAVGKEHVI
IEWQKPESDGGSELKNYIVEKREKNSSRWTRVNKTYTIYDTRLKITGLLEGSEYQFRVTA
VNSAGYSQPSDASVYILCKDPTYTPAPPSVPRITDTTKHSITMTWTRPMYDGGSDVTGYV
VEILEEGSEQWYRATAKALKTNDYVAGGLAANKKYRFRVAAINSNGTGEFSEPSAEVEPL
EKIEIPDLELADDLKKTVCLRAGGTLRLFVSVTGRPTPVVAWRKTGVELQSRGYIETTDK
YTSLVVEKVDRYDSGKYIVEAENPSGKKTATILVKVYDTPGPPGSVKVKDYTKESVVITW
DVPSIDGGAHVSNYIIEKREANMKSYKTVTTECRKTLYRITGLEEGVYYFFRVLPENIYG
VGEPCETAEAVLVCEVPSVPVKLQIVDVSKSSVTLHWEKPLHDGGSRLTGYIIEACKVGS
DRWSAVATVKASVSQHTIQSLTENDQYLFRIRATNSRGASESTDIVTPVIIQEIKVMPKI
DVTSIPQKIVHVHRGKPIDLNIPIRGRPQPVCSWYFGGVKLKDTLDRIKIDSNSKYTHLV
IRETTISDTGDYTLEVKNTIGMATEVIKVIILDKPSIPVGPVKIEEVDGVSVTVSWQPPE
NDGGANVSGYVVEQRDAHRPGWTTVSESVTRPCFKFTRLSEGTEYVFRVAAMNRFGIGGF
LQSDVVECKSAKTIPGPPSRPEVLDVTHEGMTLTWKPPEDNGGSTIAGYIIERKEARSDR
WLRINKNPVTMTRYRSSGLIEGLEYEHRITAINSRGAGKPSESSVITIALDPIEPPGPPV
QARVTDTTRTSVSLAWLPPEEEGGSVITGYFIEMQKVDQLEWTLCNTTPTKMCEYIITHM
PQGAEYKFRIIACNAGGCGEAAEIPGVVKVQEMLDYPDYELDPKYEEGYVVRQGGVIHLS
VPIKGKPIPTCKWTKDGRDISHRAMIATHDDITELVIKEAHKDDTGTYDLVLENKCGRKA
VYIKVKVIGRPDAPEGPLEFDDIQARSVRVSWRPPSDDGGTDILGYIVERREVPKAAWYT
VDARVIGNSLVVKGLKENVEYHFRVAAENQFGVSRALKSDESVTPKTPLCPPEPPSNPPE
IMDVTKSTVSLSWARPRDDGGSRVTGYYVERREVSTEKWVRHNKTHITTTMFNVTGLIPD
AEYMFRVVAQNDIGQSEPGPASESVVCKDPFDKPSQPGEIDIVSVTKDCITIHWLRPEHD
GGKEILGYWIEFRQAGESAWKKCNKERSKDRQFTMGGLMEATEYEFRVFAENETGLSRPR
RTPMGIKTKLSVGEAPALTEDIQDVTTKLGESGTLTCGIIGRPLPEIKWYRFGKELTQSR
KYKMSSDGRNHSLSILTDEQEDEGLYTCRAINEAGEIESSGKLRLQAAPQFHPGFPLKEK
YFAGAGTSLRLHVVYIGRPIPQIMWFYGKKPLNPSENVIIENTESYTHLVVRNVQRKTNA
GRYKVQLSNFFGTIDTVLRVEIQDKPCMPEGPLIVEALLKSSVVISWKAPKDDGGSMITN
YIVEKREAKEGEQWYLVSSSLSGTTCRVLNLTENAGYYFRVSAQNQYGVSEPLEIPSVVI
IKSPFEKPGIPQQPFIISSTKDSCVVCWKPPSSDGGAKITSYYLEKREKKQNKWMSVTTK
KIAETNYEVTGLIEGFEYEFRVKCENMGGESEWSEISEPIIPKSDQAPRAPTFREEIRDM
TVKYHASATFVTKVLGYPKPVVKWYRSGKEVLADGTKIKALEFKGGYYQLVITSADENDA
TVYQVRATNSSGSISTTANLEVEVPAKIHLPQELQGMGAVHAVRGDHVTIKIPISGKPEP
TITWQKGQEILSNSPYHQVITTRSFTSLVFQKGVQRKDTGYYIITAKNRFGMDKQTIEVN
VADIPEAPKGLVVSEIARDSITLVWEPPVSDGGSNIISYIVEKCPTTSDRWIRAGQTTDC
SITIINIFGKTKYQFRVIAENQFGLSPPSEPTEPITTKEDKSVIRNYDEEVDETREITKE
EALFYKVKELSSKYIISEELAHCQFGVVHRCIEIATKKTYMAKFIKVKGTDRELVLREIE
ALNVGRHKNIVYLHEYFESMEEIILIFEFISGVDIFERLGTSNFELTEQEIVKYLRQVCS
ALKFLHSHNFGHFDIRPDNIVYTTRKSTNIKIIEMGQARLLVPGENIRMLFSAPEYCAPE
VHRHDLVTTATDMWSVGVMAYVLLSGLNPFAAESTTKMIENIINCEYVFDSEAFKDISLE
AMDFVDRLLVKDRKLRMTAHEALEHPWLKMKIEHISNKAIRTLRHRRYYQTLVKRVDTIV
SAARVAYGGAFKNQRGLAVGKVKIGTECHGFRAGPVMHASAEEGGYARFTCSIAKYDKST
QVSWYFGNCQLHTSHKYEITYSNGFASIYVKDIEESDDGVYRCKVVSDDGEDSAYGELFV
ETVRSIKEYYLSRSIKKLRRRVDKTKLLQRPPEFTLPLYNRTAFIGEDVRFGVTVTVHPE
PCIIWLKNGEKIKPGDNDSKYTFTSDKGLYQLMIHNLDMTDDAEYTVMAHNKFGEDSCKA
RLTVAPHPVTEETMRPMFKRLLANVECMEGQSVHFELRVSGVPPPTLKWEKDGHPLQFGP
KVVVIQEDVDSHVLHIRETLLEDSGVYKVTATNSAGTTSCQATLKVDRLTYTRREYRSEE
EKYMHIQKQIEKTNKMAQKIVATEELVPLNPTAQEALKYAAEIYKPAVSTKNVEGEFDIT
EEKSETKKLEEERRIFMPYEIPEPVVHDPRVLDENKGIKQFVPLSDMKWYRKLKDQYEIS
ERMERIVQKRQKRIRLSRWEQFYVMPLPRITDQYRPRWRIPKLTLDDLETVRPARRSPSP
VSEALFRSRRRSLGDLSDEELRITEEEEGMMLEDELELGFSASPAGSPVHIERHAMEHEE
RRHEGRHETVEVAETKKKRTISQYMRRRRSLSPTYIELMRPVSELIRQPHARHPVEVEGE
IVGRRSPTPERTRPRSPSPIKSVERSSRSSSRFERSARFDIMSRYEARKAALKSERKYQV
VSQTPFSLDHAPRVTVRMRSHRIPVGQDTKFTLNVQAKPEAEVTWFHNGTAISESSEKFI
FTNMTGVLSITILDCQEEDSGTYRCVCSNSKGEASDYATLEVSGGSYTTFSSRRKDEEAP
KTYVPEVTRTDHYHISHFKAGYASQTHFEVEETKSKLTETHEVFTHERYGASSERYSSAE
RYDSSIKYASAEYLSSSSSYSSDKFSLSGKHTTSEAKLKSSTTAGDEEVSIQKAKLSLPA
RILTKPQSVTVEEGETVRFTCDIDGEPAPTVTWIHESRTIVSSHHIQVTTTQYKSSLEIS
SVTASHEGSYTVVVENSAGRQEAHFTLTIHRPTPKQEVKIVKPPEPSVKSPTPSVKSSAP
SVTSPVPSTTSAVPSVKSPEPSTKSIETSVTSPASSIKSPEPSATSPAPSVKSPTPSVKS
PEPEGIKSPKSIKSPEPTAPSPAQSLKSPTPGVKSPEPEGPKSPRGLKSPELRLKSPPPT
KTLGTGKSLESEEVKSPRGIKSPEPTGIKMPRGVKSPEPPGLKTPKGIKSPEPTGIKSPR
ALKSPEPEGIKSPPRMKSPPPTMSPKRVVSPPTVKSPIPKPPKVTSQLTAEACEGSVRMS
CVCESSVREVVWYVNGRRLSQSSHLEMHYSEGSCSLVIHNLTDNDQGEYTCEMKSEGGVS
KSSFNFTGQVFQSIRKKITAYCEQQLGLQGSVLMSQKESSSSLSSSVMMKKEIHTMEESS
AFSSTSQQAVMSSMTDSRSFSSMAAEMKFETMSMSSMSSVSSEAYAMSSSSLMEMASHME
GSLRALGSAPRIEALPEDISIEPGKVLTVACAFSGDARHIEWSHDGKTIELTAAGRFHIE
TTEDLTTLIITGVKEEDAGSYTLKLSNELGSDTATVHISIRSV
NT seq 86172 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaagcaccgacattcacacagccgctacagagcgtcgtggcacttgagggt
agtgccgcgacgtttgaggctcaaattagtggttctccagttcccgaggtgagctggttc
cgtgatggccaggttctttccaccaccactctgccaggtatacagatcttgttcagcgat
ggccgcgctgttctgaggattcctgctgtgacggctgcacacagcggaaggttttctgtt
agagccacgaacggagctggacaagccacaagcaccgctgaactcctcgttacagtggag
acagcacctccaaatttccttcaaagacttcagagcttaacagtgagacaaggcagccag
gtgaggctggatgtgcgagtgacaggaatcccgacaccagctgttaaattctacagagaa
ggggctgagattcagagctcagccgacttcaggattctccaagatggagacctgtatact
ttgttgatcgctgaagccttcccagaggactctgggacatattctgtgactgccactaac
aacagcggacgggccacctccactgctgaattgctagttcagggtgaggaagctgtgcca
gctaagaaactgaagactgtttccacatcccaaataacggcttcccagagtcgagtacag
agggtggagactagtttccaggcctccactaagagggagatccatgcaggggaagtaatg
atcactcagcatttggctcacaaaacccccccacgggttcctccaaagccgacctccaag
tccccgccgtcctatgtttctaaggtgacagcaggacgtcagcagtccccttcgcctgtc
agacatgtgaaagggccaacaccgacacccgtcagaccagtgtctccatccaccaaactg
tctgtttctcccatccgaccagtcaagtctcccatcatgaccaggaaacaggtatccacc
tctgcagaggttctgccaccctggaaacagggagactacgcgactgaagcgagctatacc
agcatggcaagcatgaccgctgtcagcagcaccactcaacttcatatgcagaagcactgg
gagcagcaggtggctgccaccagagaggaggtggctgcagtgcctacaagatcccaggag
cctgtcgttccaccaactcttattgctggactgaagaacctgactgtgacagaaggcgag
tcagtgaccttggagtgcaaaatcagcagtcacccttcccctgtcataatctggttcagg
gaggactacaagatcgagagctccattgacttccagatcagctacgagcacggatttgcc
aggctgattattcgtgaggcatttgctgaagacagtggccggtttacctgcactgccacc
aatgaagcaggaactgtgagcacctcctgctacctgcttgtaaaagtttcagaagaaatt
gaaagcagagaggaaacagctgtcacagaaattgcaatcacacaagaaaaaactgttgca
gctgaagcaaagctgcagacggtgacagagtttagtgcaggagaacctgcagctccattc
ttcatcaagaaacccactgtgcagaagctagtggagggaggaagtgttgtgtttgaatgc
caggttggaggaaatccaagacctcacattatctggaagaagaatggcgtgctgcttacc
actggatacagatacaaagttgcgtacaaggaaactggagaatgtaaactggagatctca
atgacctttgctgatgatgccggagaatactccatctttgctaaaaatccccacggagaa
gcttcagcttccaccagcctgttggaggaagaggaatatgaagcacatatgaagcagcac
gatgtaacatataaaactgaagtgactacaacagtggttcaggaaccctctgtggttatg
agtcagtatgaattggaacagaggaggacaataaccccgatgagctttgtctcagaaacg
gaattcctcatttcagcctttgaggagaggataatacagaagatcgaactgtgtatcatg
agaattacttacaaagagcttgtggcagaggacggcgagctggtagtgactatagcagat
gaagaggcagcgcagccagcctttgacacaccagtgaaaaactacaggatcatggaggga
gcgggagtcactttccactgcaagatggttggaaacccactgccaaagattgcctggtac
aaagatggccagcgcatcaggcctagtgggcgttaccaaattgaagttcttcaagatgga
cgagccagtcttcgtctgcctgtggtgctaccagaggatgaaggcgtgtacactgctttt
gccacaaacatgaagggaaatgcagtcagctctggaaagctttatgtggaggcatccgaa
gctgtaacaccgcagagatacacaccacagccagcagtacagaggataagatctacatct
cctcgttctctgagccgctctccagggcgttcttccagccgatctcctcggcgttctcct
gcccgtcgatttgacgaaacagatgaggctcagctcgaaagactatacaaacctgttttt
gtcatgaagccctcctcaataaaatgttctgaggggcaaactgcccgatttgatttgaaa
gttgttggcaggccaatgcctgacacatactggttccacaatggacaacaagtgatcaat
gataacacacacaagatagtgattaaagaggatggtactcagtccctgatcattgtccca
gccatgccacaagactctggagagtggacggttgttgctcagaatagagctggacgggca
tctctcagtgtaactcttactgttgatgctcaagaaaccctggcacgtcctcaatttgtt
gaaaagctgaaaaacatcactgtaaagcagggcactctggttgagttggctgtcaaagcc
attggaaaccccctgccagacatcgtgtggctgaaaaacagtgacatcatcaccccacac
aagcatccacagataaagattgatggcaccaaaggagaagccaaattccagattccatct
gcttcaggctcagacagtgcctggtacactgctacagccatcaacaaggctggtagagac
accactcgctgcagagtcaatgttgaggtggactttgctgcccctcaaaccgagagaaag
ctcattattccgagaggaacatacaaagctaaagagattgcagcgcccgagttggagccg
cttcatttgcgatacggtcaagagcagtgggaggagggtgatctttatgacaaagagaag
caacagaaaccacaattcaagaagaagctgacatctatcagaatgaagtgttttggacca
gcccactttgagtgtagactcactcctattggtgaccccactatggtagtggagtggctg
catgacggcaaacctctggctgctgctaataggttgcatatggtcaatgaatttggatac
tgcagccttgattatgaagttgcctatgctagggacagcggtgttattacttgcagagcc
acaaacaaatttggagttgaccagacctcagccaccctgatcgtcaaggatgagaaggga
cttgttgaggaaacacaacttcctgaaggcaggaagggagcatataggatggatgagatt
gagcgcgtggctcatgagggaggacctgcaggagtcggcgctgatgaagaatctgaaaag
acaaagcctgatattgtcttgcttcctgaaccagcaagggtgctggaaggtgacattgca
cgattccgctgcagagtgactggttatccggcaccaaaggttaattggtacctcaacgga
caacttatccgcaaaagcaagagatacagacttcgctatgatggtatttactatttagag
attgttgacatcaagtcctatgactcaggagaggttagggtggttgctgacaatccttta
ggaacagctgagcacacagtaaagctagagatcgagcagagggaagactttagatctgtc
ctgcgtcgtgcaccagaaccaaaacttgcagaggctacacacgagcctggcaagattgga
tttgatattgtgaagatggaccgacctagtgaggcttcacaagacagggaagtggttaag
ctgcgtaaaacacagagaattgttcatgagaaaacttcagaggagtctgaagaactgaag
agcaagttcaagcgcagaacagaggagggtttctatgagtctatttctgctgtagagctt
aagtctcgcaagagggatgactcttatgaagacctattgaggaagactaaagaggagctg
ctccatcacatgaaagagaaagaagaagctgaaaggaagaagatggaggaacagggtaaa
gtcactatccccacaataaaacctgaacgggtcctgctctctcccagcatggaagcaccc
aagatcctggaacgcattgcaagcaagaccgttgctccaatggatgaggttcgtttcaga
gtcagagtagttggtagaccagaacctgagtgtcagtggttcaagaatggcattcagctg
gaaaagtctgaccgtatttactggtactggcctgaggacaacgtatgtgaattggtcata
agagatgtcgaaacacaagattctgctagcatcatggttaaggctattaatattgctggg
gagtcctcaagtcatgccttcctgcttgtacaagccaagacagcagttagctttacccaa
aacttggaggatgcgagcgccaaggagaaggataccatggtgacctttgagtgtgaaacc
aatgaacccttcgtcagagtcaaatggtttaagaacaacatggagatcttctcaggagac
aaatacagaatgcactctgacagaaaagtccacttcctgtctgtgctaatgattgaaatg
agggatgacgcagaatacacctgtgtgatttcagatgatgagaacacgagaaccagtgca
aggcttcatgtggaaggtgctgctctcgagctcatcaaacacatggagaacattgaggta
ccagaatcctatgctggcgagtttgaggtcgagttatctcgtgaagatgctgagggcagc
tggctctttggagacaaagttctctcacccagcaataaatacatcatatcctcacgtcga
ggaagacacactttgtctgtcaaggatgtcaggaaagaggaccagggaaaatacaccttt
gtatgtggagatctgaagaccagtgcctcactaaaaatgaaactgcgtccagtgacactg
atgcagcccctgactgatctgatagtctgtgagggtgatattgctcagctggaggtcagg
ttctcccaagagaatgttgagggaacctggatgaagaatggccaggccatttctgcctca
gaacgtatccacattgtcattgacaagatggttcacaagctgctggtggagaatgtcagc
acagaagatgctgccttgtactcttttgtggttcctgcccaggacatctccacctcaggc
aaactcagtgttcaaactatcgacattgtagtgccactgaaggatgtatcctcaattgaa
ggcacaaaggctgtcctggaggctaagatctctgcccaggacatcagctctgtcaaatgg
taccataatgacaaactgttgacacccagtgaccgaatccaaatggtggcaaagggagca
aagcagcggctggtcttcaccagaacctttgcatctgatcagggtcactataaactagtt
gttggcaaggttgacaccagctgtagcctgactgttgaagaggtacacattgtgaaacac
atggaggacaaagtgtgctcagagtcccagaatgtgacgtttaatgttgaagtctctcac
cctggaattgactcaatctggacattcaggaaccagcaaatcaaacctggacccaagtcc
aagattgagtccaagggaaaggcttactctctgacagtcattgacgccatgaaagatgag
gagggccagtacatgtttcatgctggtgaaaagacatctagtgccaagcttactgtctct
ggtggagccattacacggcccctgcaggatgtgacagtggcggagtctcagactgctgag
cttgagtgtgaagttgcaaatgccaatgctgagggcaagtggcttaaggagggccagccc
attgacttcaatgagaatgtggtgagtgaggtgaacggggccatcaggcgcctcatcatc
aacattaccaggccacaggatgtcggagagtatacctaccaggtggccaactccaaaact
acagctaatctcagggtggagggagtgaagatcaagaaaactctgaggaaccagactgtg
acggagacccaggaagcagtgttcacgctagagctcacacacccagatgtgaaaggatcc
cagtggattaagaatggggtggaactccaaaacagcgaaaagtacgagatcatctccagt
ggcgtggtccagacgctgaaggtgaaggactgcaacatacaggacgagtctgtttactcc
ttcaaacttggaaaactttctgccaatgccagactcaacgtagagaaaatcaaaatcgtg
aagaagataaaagatgcaacgtctctgttggatggcacagcctcctttgagatgagcctc
tcacatgacaacatccctgttaggtggatgtttaaaggtttggagctgacgtcaagtgag
aagtgcaagattctgtctgagaggaaagcacacaaactgatcctgaagaatctggacagc
agcgatgcaggagagtacgtggctgtggttggacacttgcagtgcagtgccgtgctcacc
gtggaggctctgcaggtcactaaacccatgaaaagtgtggaggtaccagagactcaagtg
gccacattcgagtgtgaagtctcccacttcaatgtgccgtccacctggctgaagaacgga
gtggagattgagatgagtgacaagttcaggattgtggttcagggaaaactccatcagctg
aagatcatgaacaccagcagagacgactctgcagagtacaccttcgtttgtggcaacgac
caagtgtctgcaacacttaccgtcaacccggttctgatcacctccatgctgaaggacctg
aatgcccaagagagagacactatcacctttgaggtcaccgtcaactatgaaggcatcacg
tacaaatggctgaagaacggtgtggaaattaagtcatcggacaggtgccaggtccgcagc
cggcagcttacgcactccctcaccatccgaaatgttcactttggagacgggggagagtac
aagtttgtggctggctctggtgccaccactgctaatctctttgttgaagctcgtgtgatt
gaattcaccaagaagatcaaggacataaagatcacagagaagaagaaggcggtttttgag
tgtgaggtttctgagccaaacatccaggtgatgtggatgaaggatggtcaggagatggac
atgtctgaggaaaggtatattgtgacagcagagaagtatgttcaccgcctcgtgatccag
acggttcgaatgtctgatgctggggaatattcagtggtagctggatcaagtgtctccaag
gcccggctcactgtggagggtcgcgacattcggatctcggaacctcctgagcgggaaatt
acggttctggagaaacaccgtgcaacctttgagtttgaagtgaatgaagaagatgtggag
ggtcactggctgaagaatggtgtggagatccagttctcgatggaagacagatttaactat
gtgaccatcaggaagctgcatcgcctcaccatctcagagacctacaggagtgatgctggg
gagtacaccttcatcgctggcaaaaatagaagcaccatgcagcttcgaataaacatccct
gagcctcctcagatccttcgccacatggagccccagtcggtggaggctggaaaaccagct
cgcttctcagtccaggtgagcggtgttccccagcctcaggtcttctggtacaaaaactcc
caggctctctccgctggcttcaagtgcaagttcctgcacgatggcaacgagcacacactg
ctgctcatcgaggtctttcctgaagacgctgctgtctacacctgtgaggccaagaacgag
tatggcactgccacaagcactgcaacactcaatgttgaagtttcagaggtggtttctcca
gactcccccgctactgttgctccacctgtcatcatctcacccattgccagcacttcagcc
tgcgagggtgcaccagcttgcttccagtgcaaagtccgtggagatgatgtgaagataagc
tggttccacaagaaaaaggaagtcaaacagtccgaattcttcaggatatctcagtttgat
gacagctgtcagctggagatctccagggtttatccagaggatgacggcgagtatacctgc
atggccacaaacaatggagggacagtatcctgctctgcaactcttacattagacgtgact
cacgtgagagagcaggctgaaaccaagactgagctggaagtcaaagtgccccctgtcttt
aggcagaaaatcacacctctggagataaatgtcggcagtcacaccaagtttgaatgtgag
attgaagaagctccagacgtgacattcaaatggtacaaatctggcaccgaaatcagacag
agtgaaaagtatcggatcatcagctgccacactagttccactttagagctcctgaaccct
gtcaaagctgatagtggagaatacacctgcaaagcttcaaatcaacacggcacagacagc
tgcactgcctcgctcattgtcaccgagatgtacccaccagtatttgtatcaaaaccagac
ccaatgactttatatgtgggaaaacaagctgtgttccagtgctcacttactggatcctcg
cctatggaagttgtctggcacaaggacaacataacaatttcctctgaaaggaactatgtc
atgaaatgtgaaaagaacaagtattcccttcacattaaaagtcttgaactgactgatcag
ggagtgtacctgtgcaaggcttccaacagtgttggtgtagctacttttgcagtagaactc
aaggttattgacaagccccggtttgttacggtcattgagccagtatctgcagctgttaat
gacccactgaggctggagtgccacgtgaatgaggacactggtgtggctgtcacctggacc
agggatggcaaaaaagtccaccagagtatggagtgtaaactgtcctttgaggacaaggtc
gctgttctggagatccccaagtccaaactaaaggactcagggaaatatgtatgcacagct
gcaaatgaggctggcagctcctcctgtgaggctgtggtaacagttcaagagccccctgcc
tttgtgaagaaaatggaatctaagcttacatggaaacagggtatagctgcacgcttacaa
tgcacaatcaaaggatcgcctgaacttcacatccagtggttctggaatgaaagagagctg
agtaatggagacaaatataaaatatctttcaagactggagttgctactgtggagataatg
aaccttctggtcacagacagtggcagatacacctgtgaggtatcaaataatgctgggagt
gaaagctgcagtactcttttagctgttaaagagccaccgtgcattagaaaagacctgcag
acagtagaggcagtgaagggagcagctgctcacctggagtgcgaggtcacaggaacagct
ccttttgaaatcacttggttaaaaaataagaaacccatcaccagtgatcagaagtataaa
ttgatttcccaagattcgatagcaaggctggagattcaaacatttgacactacagatatt
ggagattatcagtgtgtcatatcaaatgatgtgggaaaagtcaccactaaggctatggct
aaacttaaagatccaccaactttctcaaaaagggttgagagtgttacagcagtcttggga
aatacagtaaaactacaaggaatgattaagggttcaactcccatcactgtgaaatggata
aaagactccaagatgctaagagatgacgatccaaatatcaagatggtttttgagaacggt
gttgttagtttgtcgataacaacagttgccatcagccatggtggcaagtattcatgccaa
gcggagaacgaggctgggcaacaaaagtgtgaagcgatcttgactgtgcaagaacctgcc
aggattgtagagcctgcagagtccattagtgtgacggcaggggactcagccacattggag
tgcacagtctctggaagcccagatctcaaagtgaagtggtttaaagatgggaaggagatc
attagtggccgtaaatataagatgactctgaaggataatattgccaccctgaaaattctt
actgcagaaaaaggagatacttcagagtataaaatggaagtggcgaataaagttgggaaa
gaccagtgcacgtgttcagtcactgtcttagatcggataatgcctccagctttcaccaag
tcgctgaaaagagttgacggtaacattgataatcctgtctccatggattgcaaggtgtct
gggtcacagcccatgaccgtgacttggttcaaagacgaccaggagattgtttctggagac
aaattccagcctgaatttaaagacagctctgctatattgagaatcatgtggctagaaaag
gctgactctggtgtttataaatgcagagccaccaactcagctggctttaaagaaaccagt
ggcacgctctatgtgaaagaacccccagcgttcacagtgaaaccacacgaccaggatgtt
attccaggaactacagtttccttaagaacagcattcactggaacagctcctttaactgtg
aagtggttcagggaagaaaaagagataattacagggggcacttatttcattaaaaaagat
gcctcttcaagctctttggagcttcactctgtaaagcccactgatacctcgaaatacacg
tgcgaagtatccaatgatgctgggaaggtagactgcacagtagtcctctttgtgaaagaa
cctcccgtgtttgtgaggaaacccgaggcaaccaaactcatcaccagtggtgactctgcc
gggctggagtgcaaagtaactggcagcccagtcatcagtttcaaatggttcaaggatgaa
atggagatcaatgccagttctaaatacacaatgagcttgatcgacttgatggcaactcta
gaaatagctaattgtacagtggaggacagtggagattatgtctgtgtggcatcaagtgag
gctggaagtgaccgttgcacctgcacagttatagtcaaagaaccaccattgtttctgcgt
agcttggagcacaaggacgtggtaaaaggttctgagctgacgctagagtgccaagtctct
ggttctgctccttttactgtgtcattttataaaaactccaaattgattcggaacgacaaa
agacacaggattactgtgaaagaggacctgctagcactacaggttctggcagtagaaaca
ggagatgttggtttgtaccagtgtagtgttgagaatgaagtgggaagggcctcctgtgat
tgtcacgtaacgctaaaagaaccaccatcatttgttcgaaagctggagaacctcagctca
ttggctggcagcgaggtttctctcatttgcagtctgaaaggctctgaacccatatctgtg
gcctggctaaaagacaaccatgagctcagagaggctgaaaacattcagattacatatgag
aacaagactgcgctactgcagatcaccaacttacagagcagtcactgtggtaaatactct
tgccaggtgcagaatcaggctggcagccagacatgctctgctgtgctgacagtcaaagaa
ccagcaaaaatcacagaagaagtaaagtctatcagtgtgactcagggggatccagctact
ctggaagccaggttctcaggcacaaaacccttgaaagtcagatggctaaaggctggcaag
gagctgacctcaggccagagatataaagtacagagcaaagataccagttctgtgttgaag
attattaaaactcagaaaagtgacggtggtgaatatatctttgaggtttcaaacgatgtt
ggacaaagttcatgtgatgccacactcaccattctcgatcaaataattcctccgtctttt
acaagaaaactgaaacagacagaaggtgtcaaaggatcatttgcgcatctggagtgtctt
gtgtctggttctcttccaataaccatacagtggtacaaagatgagaaagagatccaaacc
gatgacaaacacaaatgcacattctttgaaaatgttccatttctagaaatctccaatctt
gatactaaagacagtggcaattatacctgcattgctacaaataaagcaggaacggtccag
tgctctggagtcttatttgtgaaagaatccccatgcattcttgaaaaacctgaatccata
aatgttttgcctggctcaaaagtccaatttagtatactgttctctggcacaccaccactc
accaccaaatggtttaaaaacaataaagagatcctgtccagtgctgactggtctgtgatc
aaagataacacctcgagcacactggaactcttctttgcaaaaaccacagattctggagac
tatgtctgccaaatacagaacgatgttggctccgcttcatgccaagcaacactctttgtc
aaagtgcctccaaagtttacacagatcccagcccgtgtgtctgtagtttgtcctggtcaa
agtaaggtttttgagtgccaggtgaccggcacaccagagattgacatctactggttcaaa
gaaggctctgaaatcagcccaactgatcactataagatggcctttgtcaactctgtggca
acactggaagtctgtggggctgaggttaaacatagtgggctttactattgcgaagctcgt
aatgaagctggcagtgagagctgcagcatggagctgaaggttaaagaaccaccatcattt
attagagaactggctcgagctgatgttgtgaagggctccactgccattttagaatgtcaa
gttgctgggacgggtccgtttgagataacatggcacaaagatggaaaggagctcaaaccc
agtgctaaacatgccttctctcagttaaatgacactgtgtgtcttgaagtgcacaaatgt
gatgctgtagatattggtgaatatcagtgcactgttgctaacgaggtggaaagctgtact
tgtaagactacactaagcctcaaagaaccaccaacattcatcaagacaattgagaacact
gctattgttctgggtaaaatggcagagtttcagtgcattgtgaaaggctctcccatcatc
tctgtacagtggaaaaaagatgagaattggatattggaggatccaaagattcagagaaca
tttgaaaacaatgtggctacactccggattcctgcctgtgaggcgatacacagtggcaaa
tacacctgccaggtggtaaatgaggctgggcaggataagtgttttgccaccctcacagtg
caagtgcctccgcagatcacagagaaacctgaggtggtaaaggttacagttggagatcca
gtcagtctggactgtaaggttacaggctcccctgaactcagggtgaaatggatgaaagat
ggcagggaactcaagtcaatcaggcagcacaagctgatctttgagaacaatatcagcagc
ttaaagattcaggctgcgcagaaggaggatgaaggagagtatgtctttgaggtggtaaac
tacatcagtagctgtacctgcaaagtcaagctaattgtattagagcaagtaattggccca
agcttcatcaaacccctggtagacatgcacgagatattggggtcctttgttcagatatgt
tgcaaaatatctggttctctccccatctctgtggaatggaagaaagatggaaccaaaatc
tctagtggtctaaaacacaagctcattcagcaggacaactctgtgtccattgaaattgaa
cagctagagagatctgatgcagggttatactcttgcaaactgactaacacagcaggaagc
tgtgaatgcagtgggtccatcgcggtcaaagaacctccaagctttgtgacagtgcccgag
tcgcagacagctctacccaaagccactgcacgcttcaaaggcacttttaagggaactcct
cccttcacagtcaaatggtttaaggatgacacagagcttatgactgggcctacttgttta
atagggctggatgggctgtcctgtttcttagagctctattcagtgggtgtcacacagagt
ggagtctacgcttgccaagtcagcaatgatgctggctccgtacactgtagtgcaaacctg
acagtaaaagaaccacctgaatttctgctgaaaccccctgccaataagtttgtgaagcag
ggtgagtcactccgcctggagtgcaaagtcagtggcacagtccctctgaaaattacctgg
tacaaaaacgacaccaaagttacagacggtggcaactacaggacgtcctttgttgactca
gtagcagtgctagaactggtctccactagttttgaggatgatggagtttacacctgtgag
gctcagaatgatgctggcagtgtgagctgcagcactacacttaccattaaagacccccca
tcttttgtcaaaataccccagcctgttgaagggctgaagggtaaggacgtaagtttgtac
tgcgagatgagtggtacagctccattccagatcacctggtttaaagacaggaaacctctc
atggagagcaggaagtttaagctggtgagcgagggcagctcagccacactgcatgtcatt
ggaatagagccctcagacgccggcgaatacgagtgcaaagtgtcaaacagtgtaggaagc
gatacctgccacacatcaattaaactcagagagccaccatcatttgtgaagagactgtca
aacatgacagtgatactgggaggggaggtgacccttgtggccactgttaaaggctctgaa
cccattactgtgtcctgggttcaagacaaggatcacattctcagggacagtgacaacagg
aaaatcacctatgaaaacaaccaggtggcagttaaaatctttaacgctgatgcaactacg
gcaggcaaatatacctgccaactcagaaacgatgctgggagtgtggagtgtttcgctaac
ttgactgttctagagcctgctaaaatagtggacaagcccgatgctctgagtgtgacggca
ggtgatatggctgccctggaggtcaaagtgtgtggaaccccagagctcatacccaagtgg
ttcaaagatggtgctgagctggcttctggtagaaaatacaaaatctcattttcccggatg
atttccagcctgaatgtgctgtctgctgagaaagttgactctggagaatacacatttgag
attatgaatgaagttgggaaggacctgagtaaaatcaatctcactgttttagataagaca
attcctccaacattctcacggaaactgaaagactgtaccactgttgttggaaaaccttta
gaaatggagtgcaaagtgtcaggctcatctccttttaccatttcatggtaccacaatgac
gaggagataaagagtgggccaaattatgagatttcattcagtgacaacaactgtacacta
aaggtgctcacgctgaagctggctgactctggagcgtacaaatgtaaggctgtcaacaag
gcaggaaccacagaaactacagccttcctggttgttcgagaacctccaacttttgtggtg
ccaccgcagccagtggaggccatgccaggctctaacgtgacgttctcagccatggtgaaa
ggcagtgcccctctcaaactcaagtggttcagagggacaaaagagatcgtagctggacat
ggctacgatttctccctggatgataacaaagttcttttagagctttacaacgtggataaa
tctcatgctggagagtacacctgtcagatcattaatgacgcaggaaaagaaagctatcca
gtgaatctcactgtcaaagagccagcaactttctcaaagaagctgaaggacatatcagtt
gagaagggcaaaccattaactctggagtgtacatacacgggcacccccatgatcactgtg
agctggtacaaagatggccagcagatctttgcttcatacaaatacaacattaccacaaca
gaaagctcctgcatcttagagtgtctcagcactgatgacaaggaggctgcaggaagattc
tgctgccaagtgtgcaatgatgctgggaaagacacgtgtgaggcagtggtttctatcctc
gagccaccatattttactgagtcactagagcccatggaggtgacagctggagatgctgtt
tgtctgaaatgtcaggttgcaggcacacctgagatcaaagtgtcctggttcaaggctgat
ggcaaagtcaggtctagccccacctgcaagctggagtacacaaagggtgttgcctgtttg
aagctaagtaaagccaccaagtccgatatcggagagtacacctgcaaggcagagaacagg
attggctctgcttcctccagctgcagactcaatgtgctagaagctaaaacgccaccatct
ttcccaaagaagatcaccagcctacagcaaactgagggccagccagtgcgctttgagtgc
cgcgtggctggctcattgcccattgaggtgtcctggctgaaagacggcaaacctctgagt
cagggggaggaattctccatgctgtatgatgataacacagctgttctgcagatcaacaac
agtgagatgaggcactctggggagtacacctgcgtggctaccaacagtgtgggctcagct
tcatgcagagccaagctcactctgcaagaacccagataccctccagtatttgacaggaag
ttgtcactacaggaggtgacagtgggtgacagcattgagctggaatgtcacatgactggt
tctgcgcccattaaagtcacatggtccaaagaccacaaagatattcgctctggggggaat
tataagattagctgtgtggataatacacctcacctgaccattctgaaggcagataaatca
gacacagggagatacttctgccacgcctctaatgacatggggaaggactcttgttcctct
gatatcactgtcaaagagcgcaaaaatcctccagtgttcaccaaaaagccctcagagcac
atcgaggacatggagggcaaactggtgaagattgagggccgagtctctgggtcgcagccc
atgtcagtcagctggttcaaagatgacacggagatacagagttctgacaaatatgacatc
agctttaagagtaatgtggcagtgctgtgcattaagaacagccaagtgaatgacagcgga
aggtactcgtgccaggcctctaatgaagctggaaaagcctcctgtgatgtcactgttggc
atctcagaggccaagaagcccccagtgtttgacgtacctcttaaaccagcaactgtggat
gagggcgagaagctaattctcaggtgccatgtctgtggatcttcgcctctgaagatccag
tggatgaaggacaggaaggagttgacaccatccagcagcactagaatcagcttttctgat
ggcacagcatgtctggagatcagcacagtctctaaactcaatgctggtgactacctctgc
aaggctaccaacgaggctggcagcgaattctgcaaagccaaagtcactgtcaaagagaaa
cctggagcagctctgtctcctgctgaagctccagcagcttctccgtccaaaaaaatggac
aatctgttcttcattgaagagcctaaaactgcacacgttaccgagaagggaaccgccacc
ttcatcgcaaaggtgggtggtgaccccattcccagtgtgaagtggatgaaaggaaagtgg
aggcaagtgacccacggtggccggatctccattgaacagaagggccaagaggccaaactg
gagatcagagaagtgacgaaatcggactctggtcagtacagatgtgtcgcctccaacaaa
catggcgagatcgagtgcagcactgacatgcacgtagaggaaaagaaggacgtagcgatg
ctggagggagaccttcgcgctaaactgaagaaaactccatcaaagcaaaagagcccacag
gaggaaaaagacattgacatagttgagctgttgagaaacgtggacccaaaagagtatgag
aaatacgcccgaatgtatggaatcactgactaccgaggcctactgcatgcaattgagcag
ctcaaaaaagagagagctgaagaaagtggaagacaagaagtagaccgtggagacagagag
tccgatgaggacatggccagactggtggctgacctgcagaagaggatggaacggactgag
cctgtcactgtggtgaaggacatttccaatcaatctgtcttcattaatgaagaagcagtg
ttcgagtgtgagatcaagatcaactacccagagatcacactgtcctggtacaaaggcaca
cagaaactagatactagtgacaagtacaatatcaccatcagcggcgaccgccatctgctc
agggtcaagaactgccagtcatctgaccagggcaactacagggtggtgtgcgggccccac
atatccagcgccaagctcagtgtcatggaggtggaggttgagaaacatctacaggacaca
atgggtaaggaaggccagtcatgtactatgtcttgtcagatgtccatccctaatgtagag
gctcagtggtttaaaaatggaaagcagttaaaaatgaaggacagatacacatctgaagtg
aaacacaaggttcagaagctactgatcagagacctgaagcctgaagaccaaggaagatac
acctgcaagtaccaacagctggagtcttcagcagacctctgggtggaagctgaacaaatt
catttcaccaaacgcatccacaacatcgaagtcaatgagcgacagtcagccacctttgag
tgtgaagtgtcctttgacaatgccattgtttcatggtacaaagacacctgggaactgaaa
gagagccctaagtacaacttcagaagcgagggccgaagacatttcatggtcattcaaaac
gtgactgttgaagacgaaggcgtgtactcagtaattgtgaggttggaacccaggggagag
gctaagagcacagctgagctttatttgtctggcaaagaaattgaattagcaatggtcccc
attgatatgccagattcctctgttcagaggcctgaagtgcctacgtcagttgcaattcaa
gaatcttttgaattctatcattatgaagaagagattgaagatagagcagttgtaagagtt
gccattgaggagacggtggagaccaaacaagttcaaatgagagaggaaatcccaacaaaa
gttgaagaaaggcctgaagagaagccaacgccagctgtaaaggaaccatcaccacagaaa
gagcctgaagccagaaagcaagtggaggaaaagattcctgtggtttcagtcccagaaaag
gatgttcctgttcccagagaaacagaggaagttaaaaggcctactgcttccccacctcca
cctactgagaagcctggagtgccaaagaaagatgaacccaagcctcaggtaccagcagac
tccaaagtagtggcccctaaagctaagcccgaagctgagcccaagccaaaaccaaaagca
gaaccagaaccaaagccagtgcctacacccaaagcagaaccagaaccaaagccagtgcct
acacccaaagtagaaccagaaccaaagccagtgcctacacccaaagtagaacccaaggtt
aaacctgaagaaatccctgagcaggagcctgaagctaaaccagtaccagtaaagaaggtg
gtgacgccaccatccaaagtccctgaagaagctgcaaaaccagatccatcaaagaccagg
cgtaagccagctgataccaggctagaaccagacaaacctaaaccagaagctcgtaaaccc
gagccttctctaacaaaacaagaaccaaaagaacctgcagtgattcccaagcctgaacct
gtggtgaaaaaatcagaagcagaaataacagcaccaaagcctgtggtgccaaaaccggaa
cccccagtgaccaagccagaaccaactcctgcaccaaaggaacctacaaaaaaagaattt
tattttgaagcatcagaagaaccagcaaagaaggaggtttcatctccaatccaaccaccc
caacctccacttgcacaaccacaaaagtttgagacagaggaacaagcgccacagaagaaa
cctgtggcagttaaagttcctgtggaggaaaaaataactgagcttccaaaagcagccaag
aaagcagagcctgctgttgttccaccaaaggaagaaccaacaaagaaagagaaagcttgg
aagctcgaacctaaacctgtacctgaaaaaggctatcagaaggtgtttgatgaggttgct
gtgttggagcctgaacctgtgaggcttcctgagaaaatatctgaatcagtacctgagaga
cccacggagaaagtgctgaaacccaagaaaggcatgaaggaaattccaaagctggagcca
gaagatttacctgagaaagtaccagaaaaaccacgtgaggaaaaagtcccagaggaggct
gttcctaagaggaagcctgtaaaggttcctcagaaggtggttaaagaagctttgattact
gagaagcagacatctgtaagcactgaggaattcaaagttgagctcatttcgaagacgcaa
acagagatgatctctgcagagaaaacagttcacgtaaaggcccctgataaaatacctgat
actgtatctaaggccaagcctaaacaagaggtagaggaaattcttcctaaagaaaccgaa
gctaagaagactgagaggatactgcacacagagattgaacaggatataaaaatttatgct
actaaaaaagaaacagaagacaagattctcattgctgctcctgaagctttgtctcctgaa
acacaagctgcagctaaaactgaaagactagagaaagttcttgtaaaggagaaggagttg
gtgccagaaatcaaagaatcactggtaaagccagctactccacaaaaagagagcaaacca
caagctgctgttaaagatcaagaagctgccaaaaagccggaagtcactgataatgccaag
ttgaaaaagacaattactccaccagaagaaaagccagtggtcgagacaaagcccgttatg
acggctgaagaaccaactaagatgattgcagaggaggaaaaaccactaacaaaaaagata
tcacctggaacagatgaatccaaggggccagtccaagcaccaggaggagtcaagaaagag
ggacaaccaacagaggaagcaggaagaggtagaggtagagggctgaaacctaagcagacc
ccatctcctggagagggcaggggtcgggggctgaggcctggtgggaaaggaccaccacca
ccagaggaaccttttgcagggttcaagctcaaagctgtccctctaaagtttatcaaaaag
cttcagaacattgttctgcaggaagccgagtctatcggctcatctgctgtctttgaatgt
gaggtctcaccttccactgctgttacttcttggatgaaagatggtagtaatcttcgtgag
agccccaagcacaagttcacttcggatggcaaagatcgcaaattgaacatcattgatgtc
cagctgtctgacactggggaatatacgtgcgtggccaagaacgctggcaaagagatatct
tgcaccgccaagcttatcgttgaagagctacctgtgaaatggatcaaagaactggaggag
gagacatcagcaatcaagggtcagcctgtgtatatgacctgcgagctgaacaaagagagg
gatgtgatatggaagaagaatggtgaggtcctcaagaaaaaggagggcaagattcagatc
aatatcattggtatgcagcatgcagtgaccatccagaactccacggaggaggacgccggt
gttttctcgtgtgaagtggctggccaggaagacgttaagactacaacaaatgtcaaagtg
attgaaattgtcaaagactggatagtgagaccactgagagatcagcatgtaaaaccaaag
gctgctgcaacatttaaatgcgagcttttcaaggaaactcccaactggaagtggctcaaa
ggagagaatgaagtccagccatctgacaagattgagatcaagaaggaaggaaaggagctg
acgctcgtcattaagaactgccagcctgatgacgtagcagaatatgcactggaggtggaa
ggacgcatctacactgccaagctaacacttggagagcgggaggctgagatcctaaagcct
ttggtcagcgtcgaggtggttgagaaggaagatgccatgtttgagactgagatttctgag
gacgacattcctggggaatggaagctcaaaggagaggttttgaccagatcccctacatgc
gacatccaaatggagggtacagtgcgtagactcaagctaaaaaactgccagctggaccag
gcgggagaagtgacttacacggctctgaacgccataaccagcgccatgcttaatgtcaaa
gaacgtgacatcaaggtcgtccgcccactgcacagcgtggaagttacagagaccgagacg
gcgaagtttgagacagagatttctgaggaggaccttcatgccacctggaaactgaagggc
gagacacttcatccatctgctaatgtggagatcaaggaggaagcaacccggcacttgttg
atcctctataactgcaaaatggacatggctggaagtgttgactttgcagcagcgaatgcc
aaatcctcagctcagctcagggtcaaagcccgagtgattggcctccagaggcctctgaag
gacgtcaccgtgactgctggggagactgccacctttgagtgtgagctgtcatacgaaggc
atcgctgtcgagtggttcctggggggtacaaagctggagccaagcgatagagtggtgttg
aaggcggagggtaaagtccacaccctgactctacgcaatgtcgagcaaaacgaagctgga
caaatcaaactcacagccaaagacttccagactgaggccagtcttactgtcaaagaacca
ccagtggagttctctaagcctctggaggaccagacagtggaagaggaagccactgccaca
ctcgaatgtgaagtttccagggaaaatgcagaagtgcgatggttcagggatggacaggag
attcgcaagacaaagaaatatgagatgatcattgacggctgcaagcgagcgctggtcatc
cacgactgcactttggacgactcaaagacatatgcttgtgatgctaaagacttcaaaacc
tcatgcttcctcaatgttgaacctccacacatcgagttcacaaagccactccacgacgtc
gaggttgtagagaaggaatctgccaggtttgaatgtgaagtgtccagagaagacgtcaaa
gtccgctggtttaaagacggaaatgaaatcagaaagggaaagaaatacgaaattattgca
caaggtcgccagcacatcctcatcatccacaagtctgtgtttgacgatgaggctgaatac
gaatgtgatgcaaagacctcaaagtcctctggcatgcttactgtcgttgaggaggaggca
aggttcaccaagaacctgttcaatgtggagggaactgagaccgacagtgtaaaacttatt
tgtgaagtctccaaacccagcgcagacgttatctggtacaaaggagacaaggagctgcca
gagggtggccgctatgagcaaactgtagatgggaagagaaggatactcctcatcaaggat
ctgaacatgtctgatgctggagagtacaactgcaggctaagtcccagcaacaaaacgtca
ggaaatctcaagattaatgaattagctgctgagttcatctcaaggccacaaagcctagaa
gtggtggaaggagagaaggcagcgttcacgtgctccgtatccaaggagacctatgaagtc
aaatggatgaaggatgacgtggagctcgaggccggagagaaataccagatagtcaccgat
ggcaagagacgaacccttgaaatcaaggactgtgaacttaaagatgagggtggatacata
gttatgattggaccaactagagccagcgccgaccttactgtgctcgagaaactgaaaatc
atcactcctctaaaagacacagagggcaaagaaggtcaggaggtcgtcctgaactgtgag
gtcaacacagagggagcaaaggccaagtggctgaagaacgacgacaccatatttgagagc
agcaagtacgtaataacccagagagacaatgtcttctccctgagaatcaaagatgtccag
aagggagacgaatctaactacagcatcaacttgaccaatcagagaggagagcatgccaag
agccactgcagcctgaccatcagagaggagagtctaagaattgtggttcccccagaggac
attgacactcaggagaagaggaccatcagcttctcttgtaaggtcaacaggcccaatgcc
actctgaagtggatgaaggccggtgaggagattaccttcagcaaacgcattgtctacagg
gttgacaaagacaagcatacgcttaccatcaaagactgcaccctggccgatgagggtgaa
tacacagctgtagccggagatgacaaagccacagcagagctcatcatcagcgaggcaccg
acggatttcaccatgcaactaaaagaccaaacaatcaccgagttcgaggatgcagaattt
acatgcaagttgaccaaagagaaagctgaagtcaagtggtacagaaatggccgagagatc
agagaaggacccagatacatatttgaacgagatggaaagatttgcactttgcgcatcaag
gaatgcagacctgatgatgaatgtgaatatgcctgtggtgtggaggagaagaaatccaga
gccaggctttttgttgaagagaccccagtggaaatcatcagacccccgcagaacgtgttt
gaacctccaggctcggacgttgtgtttgaggtggaactcaacaaagacagagtggaggtg
aagtggttgaggaacaatatgaccgttgtccagggagacaaataccagatgatgagcgag
ggtaaagtccacagattgcaggtctgtgagatcagacctcgggaccagggagagtacaga
gtcattgccaaggataaagatgcaaaggccaagctggaactggcagctgtgccacagata
aagaccactgaccagagctacgtcacagatgttggaaagcctattatcatggtcgtcccc
tacagtgcctatccacaagctgaagctgactggctgtacaacaacctgagtctgcaaaag
gacaacatctacacctcagctgagcacacagagtaccgattaaagaaccccaagaaggtc
gacgagggctcctacaagatcatcatcaaaaacaaacatggagcgggagaagctttcatc
aacctgaatgtcattgatgtcccaggacctgtgaagaacctccaggtgactgacactgca
gatggtgagatcagcctcgcatgggaggagcctgagagcgatggcggcagtaaagtcatc
ggctacgtagtggagagacgtgatgtgaaacgtaagacctggacactggccaccgaccat
gccgaaagtcctgaatacacagtgaccggcctccagaaggactccaagtacctattcaga
gtctgtgcccgaaaccgggttggcagtggacccactgtcgagactgacgaagctgtgcaa
gctaagaacaagtttgatgttcctgaagctcctctgaatgtgattgtgggaaacgtcacc
aagtttggctgcactctgtcttgggagcctcccacgtcagatggaggctctcccattacc
tcttatatcattgagctccgcgacaggacgtcagtgaagtggtctcctgtcctggtgacc
aaacctgatgacctcagtgccatcattaatgatgtaattgagaataaagagtacattttt
agagtgaaagctgagaacagagccggtgtcggcaaacccagtgctgcctcacagcccgtc
aaaatcatggatccaatcgagcgtcccagcccccctctgaacctatcctggcaggaccag
aacaagagctcagtgcagctcacctgggagactccactgaagaacggaggcagcatgatc
accggatacatcattgaacgctgtgaggacggttctgacaagtggctccgctgcaacgcc
cgtctctgccctgacctcttctacaaggtgtcaggtctgaaatatgggactaagtacaac
tacagagtgttggctgaaaatgctgccggagtctctgagccttcaaacatcatcggacct
ctgctagctgacgacccacatgttggtccaagctttgacctgagtgcttttaaagatggc
ctggaagtgattgttccccagcctctgaccatcagagtccccataactggatatccaata
cctgttgctaagtggaccttcggagagaaggagctatccagtgtggataatgagcgggtt
ttcctcatgacaaagtcaacatttacagaactaatggtcactccgagtgtccgtccagac
aaaggcatctacacgctacatctggagaatgatgtcacatcggtctctggagagattgaa
gtcaatgttattgctgcacccagtgctccaaaggacttcaaggtcctcgaggtgactcgg
cagcatgtccacctgagctgggaggctccagagcatgatggaggaagtcctctgattggc
taccaggtggagaaacgagatgtgtcccgcaagacctgggtcaaggtggccacagggatc
caggatctggagttcaccgttactgacgtggttgaagggaaggagtatttgttcagagtc
accgcctgcaacaaatgtggaccgggagagccagcatatattgacgagccagttaacgtc
tcctctcctgcaactgtccccgaccctccagaaaacctgaggtggagggacaagtcagcc
agtggcatcttcctgacctgggagccgccaaagtatgatggcggaagtggcatccggggc
tacaatgttgaacgctgtcagagaggaacagataagtgggagccctgtggggacttggta
cctgagctgaagtgccaggtgacgaatcttattgagggtcagtggtactcttacagaatc
agagccctgaaccgacttggagccagccggccctgcaaagccactgatgagatccaggct
gttgatcctaaagagcctccagagatccagctggatgccaagcttctggctggtctgact
gctaaggctggcagcaagattgaacttcctgctgatgtgacaggtaagcctgagccacga
gtcaagtggaccaaagccgacctggtcctcaaaccagacgacagggtgtccattgacacc
aagccaggacactccacggtcaccatcgccaagacaaagagagatgacagttccacttat
atcatcgaagccaccaacagcagcggtcgtgccactgccactgtggatgtcaacatcctt
gataagcctggtcctcctgctgcttttgacatttctgaaatcaccaatgagtcctgcttt
ctggcttggaaccctccacgtgatgatggtggctccaaagttaccaactatattgttgaa
cggcgagctgctgatagtgagatctggcacagactgtcctccactgtgaagcagaccaca
tacaaagctaccagtctgatcaagttcaaggactacatcttcagagtatttgctgaaaac
cagtttggtgttggtccagctgctgaacacacaccaatcactgccaaatacccctttgat
actcccggggctccttacaagctggaggcttcagatattgcaaaggactctctgaatctg
aactggtatgagcctgatgaggatggaggaagcccaattactggatattgggtggagaga
tacgaagctgaccatgacaagtggataagatgcaacaagctgccagtcaaagacacaaac
tacagggtcaaaggtcttccaaccaggaagaagtataagttccgagtccttgctgagaat
ctggccggaactggaaaacccagcaaggagacagatccgatccttgttaaagatcctatt
gaccctccatggccccctggcaaacccacagtgaaggacgtagctaagacgtcatgcttc
ctaatgtggaccaaaccagagcatgatggcggagcaaggatcgatagctatgtcattgag
atgctaaagagcggcaccacggactggatccgcgtggcagagaacatcaccatcctggaa
tatttcctaaagggcctgatggagaagcaggagtactcatttagagtgcgagctgttaac
gtggctggagagagcgaacccagtgaacccagtgacccagtgctctgcaaagagagactc
aaccctccctcagctccacgctggttagaggttgtcaacatcagcaggaacagtgctgag
ctgaaatgggcagctcctgagcgcaatggaggttcagccatcaccaactatattgtggag
aaacgagatgtgaggcgtaaaggttggcagactgtggataccacagtcaaagagctcaag
tgcgacgtgaaaccgctcaatgaaggatcgctttatgtgttccgtgttgctgctgagaac
gctgtgggtgtcggacccttctgtgagatggaggactctgtgctggcaaaagacactttc
actactcctggcccaccatacgctctcgctgtcagtgctgtgaccaaaagatatgtggac
ttgcagtgggaggcaccgaaaaacgatggtggaagacccatcctcaggtattccattgag
aaaaaagagaagcttggaactcgctgggtgaaatgtgggaagacttcgggtccagactgt
aagtacagggtaacagacgtcattgagggaacagaggttcagttccaggtccgagctgag
aacgaggctggcagtggacacccaagtgaacccaccgagattctcaccatagaagatcca
acaggcatcccatcaccacccattgaattacacgtgactggagccagccgagacttcctg
gcaattgcctggaaacctccacaaacagatggcggtgcccctgtcagaggataccacatt
gagatgtgcgaggctggaactgagaagtggatgagggtgaactcccgtccagtgaaggag
ctcaagtaccgcgtagaggagggtgtgacccctgaaaaggagtacattctgagagtgagg
gccgttaacgctatcggagagagcgaaccatcggacatctctgaaaatgtctttgccaaa
gactctgactgcaacccaactctggaattccagactctggatctagttgttgtggaaaca
gaaaagctgcacattccagttccctttagagcagtccccttacctagaatcacctggcac
aaagatggcaaagagctgaaggcggatgaacgccttggctttaggaaggagtatacctcc
tgtcacctggagattgacagcagtcttcatgccgatgctggagtgtacaaagtgacacta
gaaaacaagctgggaagtgccagtgccaccatcaatgtcaaagtcatcgggcttcctggt
ccttgcaaggaaattgtggcttctgagatcacaaagagctcctgtaaagtttcatgggat
ccaccagattatgatggtggtagtccagttcttcactatgtcttgcagcggcgtgaggct
ggcaggaggacatacgtcaacataatgtcaggagagtgcaaggtgagctgggtggtcaaa
gatctcatccccagtggagagtactacttcagggtccaggctgttaacaagattggagga
ggagagttcatcgagctccgcaacccagtcatcgccgaggaccagaaacatgctcctgac
ccaccagtggatgtggagacccacaaccccacatccagtactgttactctaacctggaag
gctcccatgtatgatggtggctccaaaatcatgggctacatcctagagaagcagcagaaa
ggagaggacaagtgggagaggtgcaatgacttcctggtgcctgtactatcctacaccgtc
agaggattgacagaaggaaagaactacacctttagagtaagagctgaaaatgctgctggg
atcagtgagccatcacgcaacacgccatttatcaaggccgccgataccattgattctcca
aaggttttcctgagtggcagcttgcagtctggtctcagcgtgaagcgaggttacgagatc
tgcctggatgccaacatttcaggatctccgtaccctcagatcacctggtactggaacaac
caatcaattcgacctgagccactccggaagagacctgaaaaacccctgaagaagaaggtg
gaaaagaaggaagaggaaaagaagcaggaaaaggagaaagaagaagggacagctgagaag
aaagaggagaaggagggagaggtgaaagaacctgaggaaaaagaaggcgaggtgaaaaag
gaggaggaagttccagaaccagaggtggaggagccagactaccccaccataaatgaacgc
ctggccatcgacaatagccacaagggtgtatcctctatcattatcagggactcgattcgc
cctgatcatggtgtctacatggtgaaggtggagaacgaccatggcattgcctcggcaacc
tgcgaggtcaacgtactcgatactcccgggcctccagtgaactttagattcgaggaggtg
aggaagaactctgtgatctgcaagtgggatcccccactggatgatggtggcagcgagatt
ctcaactacaccctggaacagaaagacaactccaagctggagattggttggagcaccgtt
accgcaatattgaaaggatgtcgttacttggtgcccaaactcattgagaagaaggagtac
atctttagggtcgtggctgagaacaagtatggtgcaggcccaccctgtgtctccaaaccg
gtcattgccaagaatcctttcgaacctcccgaagcacctgataaaccacaagttgatgac
atcacagccaatagcatgctggtcacatggaatgaaccaaatgataatggcagccccatc
ttgggatactgggtggagcgccgtgagatcaacagctcacactgggcacgtgtaaatagg
aacatcatccctgtccctgagctaaatgttgaaggtctgatcgaggggcttacttacatc
tttagagtggctgccgaaaaccaggccggccctggaaagttcagtgttccctctgaaccc
aagactgcccagccagctattttgcctccaggtcctccagttgcccgagtggcagcaact
actgaccactccatcgaagttgagtgggacccgcctgctgacaatggaggtggggaaatc
ctgggatatcacgttgataaggctatggctggtacaaaggactggtcgagatctacggaa
cgtccatggaagactcggaacttcactgtttatggagtcagagagggagcaaagtacatg
gtcagagtcattgcctgtaatgctgctggagagggaacaccaggattcacagagtctgta
tttgtcagaaatcctgcagagatccctgtaattgaattggatctgtctgtcaagaatggc
gtcgtgatcagagctggagaaaacctccttatacctgctacagtcacaggtaaaccctac
ccagccatcacctggaccaaggatgatggcaaacctgacaaagaccgtgtggagatcctc
actgaggacaacaacagcatcttctcagtcaagaatgttcagaggaaagactgcggaaaa
tatcaaatctccgcttgcaaccccagtggcaccaagtctgcatggaccagagtagaggtc
atggatgtccctggacctgtcacagacctgaagcctgttgttgtcactcgtaagatgatc
tttctgaactgggatgaccctgaagacgatggaggcagtgacttaaccggcttcctcgtg
gagcgaagagatcccaagatgcacacatggaggcaacctgttgaaaccacctcgtccaag
tgtgagtgtgtgggcattatggagggacaagaatacctgttccgtgtcatcgccaagaac
aaatacggcctgggcccacccgttgaactaggacccatcaaggctgtagacccacagggc
ccgccatcatatcctgagaagttccactacactgaacgcacaaagaactccatcacattc
gcctggaaaccaccacgtaatgatggcggcagccctatcattggttactttgttgagaaa
aagaggcaggaccagcaggcctttgagccctgcaacactgagatctgtcccaacatgact
atgactgtggagggcctggatgatgcctggatgtacgagttcagaatcaagtgtgccaac
cttattggagagagtgagccatccatcccactgactgtggttatccaagatgatgaagtg
tctcctgagattcacatgctgaagcagttcaaaggggacaccattactgtgaagaagggt
gaatccatcgagatcccagctgatgtcctgggactccccatccctaagatcgagtggtct
aaggatgacgtagtgatcgagaagcctactgagactctactgatggagacaaatgtgact
ggcagaatgaattgcaagaccatgctgtccatcccagcagccaacaggagggaccgtggc
agttacactgtggctgcctccaacaacatgggttcagccaagcacacggtctatgtcatg
gtgcttgaccgaccaactccaccaaggaatgtgacagtatccaatatcaggggtgagtcc
tgctacctcaactgggacgcaccacttgataatggcggaagtgaactgaccaactacatc
attgagaagaaggaagtggtaacagaggtgcctgaggtggaagagggacaggaagctcca
cctgaaccgcagtgggaggaggttacaaatagcataattgagagaaaatatggggtctgg
aacctggaaaacaaaaagacctaccttttccgggtacgggctgagaaccgctacggtaaa
tctgatccctgcacaactgaggaagttcatattatagaccccttcggccttcctggccca
ccagagaaaccaacaatcgcagagtactgcaagacctccatgactctaacctgggaacct
cccagagataatggaggctccacgattattggttactggctggaaaaaagggagaaaggc
actgcttactgggctaaagtcaataagatgcccatcacaaagaggggcatgaaaggctgg
gagtaccaggtgacacgtctgtttgaaggaacagagtacgagttcagagtcgcagcctgt
aattcagcaggaaccggacctttcagtggaccatctgactctgcctttgctgttgaccct
ctcactcctccaagcatgcctgctgctcctgaggtggctgataagacaaaacacaatgtc
acactctcctggaaaccaccagagagtgatggtggcagtcccatcaagggctacattatc
cagatacaggatgaggggacatcagagtgggtgagagtaaatgatcctgaaaccctgcac
cccactactgagtttacagtgccaagcctccgcgagctgaagcgctaccgcttcaggatc
attgctgtcaatgacattggagagtctgatcccagcccccgcactagtgaagttcttatt
gaggatgtccaacttgcaccttcaatcacacttgatgtgatggcagatgacctggtttcc
atccgtgctggagatcccattagaatccccaccaccatcaaaggccggcccactcctaag
gtaacctgggactttgacggcaaagccaagacgcacaagaaaaacaaactccacacactg
cctgtggactctgaggtggagtccacagacaccacttctgttgtgactatacctgtcagt
ctgaggagtcactctggacgttacaccatcacagccaagaacaagtctggacagaaacac
ctcaacatcagggtcattgtcctcgatgttcccggacctccaaaggacttaaagattact
gacatcacccgatcaaccatgaggctgatctggaagctccccgatacagatggaggagag
cgaatcaagagttactttattgagaagaaatctgtcaccgacaaggcctggaccaaggtt
aatgtagcctgtgctagccaggcctatgtggtgccaggactgctagagggtcaggactac
ctgttcagagtgcgagcagagaaccgattgggattcggcccattcactgtcaccactgaa
cctgcccgggccagagaccccatctacccacctgacccccccaccaagctgaaggttaac
ctggtgacaaagaacactgtcaccttgagctgggaggctcccaaaaataacggtggctct
cctgtgaagcattacatcattgaacgattgagctgggacaccaccagcaaggagaaagag
acctggaaacagtgcaacaagagagatgtggaagagctcacctttgtggtagaggatctc
aaagagggaggagaatatgagttcagagtaaaagctgtaaatgctgctggacccagccga
ccctctgccaccattggacccatggtcatcaaggatcagacatgtccgcccactattgaa
ctacgtgaggctatggagggagaggagggctgtgacatcagcattgttgcgaaagttagt
ggctgtccattccccagcctcgtttggcacaaagccagtctggacaaacctgaggagaag
tctgccattcagtatgaccaacatatcaacaaactagtaacccaggataagtgcaccctt
ctaatacagcaagccagcaggcatgacagctcactctacagcctgacagccactaatagt
ctgggcactgtttgcaaggacatcaagctcttagtgtttggacctcccggtcccccagtc
ggaccaatcaagttcacggaggtgtttgcagaaagaataggcctcgcctggaaccctccc
atcgatgacggtggatctaagatcaccaactacgtggttgagaagcgcgaggagaacagg
aaatcctgggtccatgtctccaatgatcccaaagagtgcacctatgtggtaacccggctg
acagagaaccatgagtatgagttcagagtcatggctcaaaacaagtttggagtaggccca
ccactggtcagtgatccagagaaggccagaaatctcttcactgtccccggtcagtgtgaa
aagcccactgtgacagaagtctgtctggagtcaatgactgtcaactgggaagaacccaag
tacgatggcgggtcccccatcactggctacatcatcgagaagaaggagaccactgccaag
cgctggatccgtgtcaaccgtgagcccattagggcactgccactgggcaacaactgggat
gtcactggcctactggaaggggccgtataccagttcagggtcattgctgtcaatgctgct
ggctgtggactgcccagtataccttctgaccccatactctgcagagaccccatcaagcct
cctggaccgcccactccaaaggtaacagactggacaaagtctacagttgagctcgagtgg
ataccgcctctggtggacggagggtcaaaagtcacaggctatattgtggagttcaaggag
gtgaacaaggaggaagaggagaagaaagctcagaggaggctgctcctgagtgtagctgaa
gaggagaaggaaacagaaactgaggaggcctgggtgaaggcaaaggatactgagatcaga
ggaactaaatttgtggtggctggtcttaaggaaggtggtctgtaccgcttcagagtccga
gctgtgaatgctgctggagtaggagaccctggattagtgtctgagctaattgaggtcaaa
gacagaacaattcctcctgagatggatcttgacgcctcagtgaaggagaaaatcgtagtc
catgccggtggcaccatccgcattatcgcctacgtgtccggcaaacctaccccacagatc
acttggtgccgagatgacagtgaggtgcccaaagaggccgtggtggagacgacaggcatc
tctaattcactggtcattaagaactgcagacgccaacaccagggcatttatacactaagt
gcaaagaacgagggcggagagaggaagaaggcggtcattgttgaggtcctggacgttcct
ggaccagttggtcttcccttcactggagagaacctgaccaatgactcctgcaagctgacc
tggtactcccctgaggacgatggcggctcagccattaccaactatattattgagaagaga
gagtcagaccgcatgggttggacctctgtatcttacacagtgacaagaaacaatgctgta
gtacaaggactcattgatggcaaaggctacttcttcagaattgcagctgagaacatcata
ggcatgggacctttcgtcgagaccgacaagatggttctcatcaaagatcccatctctgtc
ccagagcgtcctgaggatctaatcatcacagctattaccaaagactccatctctgtcacc
tggagaccacccaaatatgatggtggtgcagatgtgatcagctatgtccttgagtcccga
atgataggccatgacaactttgtgagagtaggcagagaggacaagctgatggacagaagg
ttcacactaactgggctgaaggaaggctcaagccatgagttcagagtctcagctgtcaac
caggtgggacaaggcaaaccatcgtttgccaccaaacctgtgcagtgcaaggatgaactt
gagccaccgactctggacctggacttcagggaaaagctcatggtaaaggtgggagacaac
tgcatgctgtcgggacgctacagtggcaaaccggcccctgctatcacctggacaaagaat
gatgaggacctgaaggcagatgaggacatcagcctccacagcaccacccaccacctcagc
ctcaacatcagcaaggccaagagagaacacagcggccgctattgtgtcagcatagagaat
gctgctggcactcgctcgggaatctgcaccatcactgtggtcgaccgtcctcagccacca
gagggacccgtcgagttcaacgaagtctacaggaattacatggtaatctcctggaagccg
cctctggatgacggaggctgtgctgtctccaactacatcattgagaagagagataccaac
agagacctatggatgcctgtcacctcatcctgtaccagaaccacctgcagagtgccaaag
ctaatcgagggccgggagtacatcattcgtataatggctcaaaacatctatggcatcagt
gaccctcttctgtctgcagagactaaagctagagacattttcaagacaccagatgctccc
aagcagcctctggtgaaggaagtttaccatgactctgccctaatcagctgggagccgcct
gctgatggagggaaaccaatcacaggctacattgtggagaggaaggagaccatggccaac
aggtgggttcgctgcaacacagaaagaatccatcctaaggtggagtattgggtgactgac
ctcctgaaaggctgcgagtatgagttcagggtcagtgctgagaatgaagtgggagctgga
gacccaagcccaccatctaaacctgtctttgccaaagatcccattgtgaaacctagtccg
ccagtgaatctaaaggctatcgactttaccaaggagtcagttaccctgtcatgggagcca
cctaccgacactggcagaggaaaaatctttggatacttgctggagttccaggcagctgga
aaggaggaatggcacaaggtgaaccagactccagactcctgcaaagaaaccaagtttaag
gttatcaacttggaagatggtgttttgtaccgcttcagagtcatggctgtcaacgctgct
ggggagtccaacccagccaacattactgagccaattagagtacaggacagacttgagcct
ccagagttgattctagatgccggaatgacccgagaaattaaggccatggctggcactcat
attgctctgatagccggcatcaaaggtgtcccatttcctactgtcacctggaagaagaat
gacgcagaggttccccctcgggcagatatcgaaaccaaccagacaggcaccaagctggag
atgaggttctgccatcgtggtgactgtggagattacaccctaactgtggagaatccagct
ggaaccaagactgtcacctgcactgtgctagttcttgacaaacctggtcctgtccagcac
ctccgtgtgtctgatgtcaggagtgactctgcctacctgtcctggaaagatccagaggat
aatggtggtactcgcatcactaactttgtggtagagaagaaagacacagcttccactcag
tgggtccctgtctgctctacatcaaagaagcgcagcatgatgttgaagcacctgatggag
ggcacgtcctactcgtttagagttgccgctgaaaaccagtttggccgcagcgaatatgtc
gagacaccaaaggccatcaaggcaatgaacccgctcttccctcctggtcctcccaaagac
ctgcatcatgttgatgtggacaagactgaggtatggttagcatggaactggcctgatcgc
aatggaggaagtgaaatcacaggctttctggtagagtaccaggaagagggagagaaagag
tggtatgaatggaaaaccgtcagcatccctgagagtcatgtgactggtctggaggaagga
aaaacctaccgcttcagagtgagggctgagaatgccattggcctcagcagacctgatacc
acagtgcctatcctctgccaggagaaactagtgcccccaattgttgaagttgatgttaaa
ctcactgagggcatcattgtgaaggccgggactaccatcagactgccagctataatgaga
ggaatccctgtcccaactgccaagtggtccatcgaaggagaggagatcaccagccagggc
aacattaagattgacactgataatttctccactattctcagcattaatgagtgcaccaga
aaccacactggaacctacctgctcactgtgtccaacccagcaggaaccaagacggtggcc
ttaaatgtcactgtactcgatgttccagctgctccgattggacctgtcaacatactggag
gtcatgccagattccatgacaattgaatggcgtcctcctaaagatgatggtgggacccct
ataaccaattacattgtggagaaaagagagtccaacaaagaaacgtggggaggtgtgagt
tctggtagccttgccacgaagctccggatcactcgccttcagaaaggagtagaatatgta
gttcgcattcgtgctgagaacaagatgggcattggtgcccctctggagagcaagcccact
gttgctgagcactccttcatgccccctagtgcacctggtaagccacaatcctatgatacc
tcggaggatgctgttacacttggctggactatgcccctaactgatggtggcagtcagatc
actggctacatcattgagcgcagacacaagggaggaaagtggatccgtgtcaacaagaca
ccttgcaaggacctgaggtaccgagtcctgggcctctacgagggcagcgagtatgagttc
agagtatttgctgaaaatattgctggatatagtggcccctcccccatctctgacccctgc
aagccctgcaggcccatcactgtcccgagtccccctgtcaatcctaaagttaaagattac
agcagggccactgctgacctggtgtggaccaaacctaccaaagacggaggcagcccaatc
cttggttacactgtggagatgaagaaagctagcgctgaagaatggaaaaaagtcaacctg
gatgacttgatcaagcagtgtgcctacagggtgaaggctctggaagagggtgtgacctat
agattcagagtctttgctacaaacatgattggagacggggagccgagagaaatcccagaa
tcagtcactgctcaggatattcttatacctccagagattgagatggaggccacttgtcga
gattgtgttactgtgcgtgttggacacaacatcaacatcattggttacatcaaggctcgc
cctgatcctgaagttttttggtcaaaagaagagactattctagagaacagcaaacgtgtt
accatcctgcagaatcttcctttagtccacctaaagatcaaggaagctacaaggaatgac
catggcaaatatattctgaaagcttcaaatgaaggtggtgaggcttcccgcacaatcacc
gttaatgtgctagaccgacccagccactgccagaatctgaatgtaacctatgtcaccaag
gactcatgcatgatcaactgggagagccctaaggacaatggtggatccgagatcaccaac
tacattgtggagtgcagagagcctagtattagcatgtggtctatgatctcttcccactgc
actaatcgtaagatcaaggcaaagctgatggaaggccatgagtacctgttccgtgtctgt
gctgagaacaaaataggaccaggaccctccgtggagaccaaaactcctacattggccatt
gaccctattgacaagcccggtgagcctgagaacttcagagcaattgacattggtaagaac
tatgtcaatttgaggtggcggaagcctgactatgatggtggaagcccccatctgtcctac
aacctggagtgtaaaactaaagatgcggagcagtgggaaaaactcaacaccactactctc
acagacaccttctttttggctgataagtgtgtggaaaatcagacgtacaccttcagagtg
cagactgtcagtgaaggaggtgagagtgcctgggtaaaacttgcagatattctggtgagg
gaggagatccagaagcctgtcattgacctgaagttggctggaacactgacagtaaaagct
ggagagtcagtcaggatggaggctgctctgagaggaaagccccagcctgaggttaaatgg
atgaaagataaggctactggagacaatcccagaataagctatgaaactggcccagactac
tcaaaatttctgatgactaagtccaagcgtagtgacacaggaaaatacattatcactgcc
accaactcggccgggactttcacagcatatgccaatgttaatgtcctggacattcccggc
ccagtgagagacctgagggttactggcatcggagctgacaagtgcagagtggtttgggat
gctccagaggatgatggaggttgtgaggtggacagctacattctagagaaatgtgaaacc
aggaggatggtttggtccacatattcagcctctgtggtcacaccatactgcaatgtcagt
cgtttggtggagggcaatgaatacatattcagagtgagggcagaaaacaagatgggaact
ggccctgccatggagagtaagcctgtaactgtcaagactcagttcaacaaacctggaccc
cctgaagcccctgaagtcaccaaggtgagtaaagatgagatgactgtggtctgggctcct
cctgagaatgatggcggaaagtcaatcactggctacatccttgaaaggaaagagaagagg
gcagtgcgctgggtgccctgcactaagagcccaatctctgagagacgcatgaaagtaacc
aacttgattccaaaccatgagtaccagttcagagtgagagctgagaatgatgtcggtctg
ggagatcccagtaaaccttgcagaccagttgcagccaaagatcctattgagccacctggt
ccccctgcagccctgaaggtggccgacagcacaaaaacctctatcactctgtcctggtct
aaacctgtctatgacggtggcgcccccattattggctatagcttggacctgaggctgaaa
agtgaggcggaccctgagaatcccacagtgggctggaagagaattgatactcatggacca
ctggtgctcacagaatttactattggccagcttgatgaaaagcaggagtatgagttcaag
gtgtcagcccaaaaccaggtgggctggggacgccatgcttatttgaaggaggcagtgtct
cccaaggagatcctggaggctccagaaattgagctggatgccagtctgaggaaaggcctt
tctgtgagggctggttgtcctataaggcttttcgccgtgatcagaggaaggcctgccccc
aaggttacgtggaagcggttgggtgtggacaatgtagtccgccgaggtcacgtggaccag
gttgacaccatgtccttccttgttatccctgagagcaccagagaggattctggaaaatat
tcactcactctgtccaactcagctggagagaaagcaatatttgtccgtgtcaaagtcctt
gacacacctgggccggttggcagcctggatgccactgacatcaccaaaacaacagctcaa
ctctcctggttgccaccagagaatgacggaggcagccccatcctcaattacgttgtggag
aaacgagaggttgataggaagacctggaccaagtgcatagaggacctgaagaagactagc
ttcaaggtcaccaacctcacacctggcattgagtattacttcagagtcatggcctgcaac
aagtatggcattggagttcctcaggactcacccaggtcctacttggctgttgacccaatc
agtgagccagaccctccaaagaagatggacgtgttagagatcaccaagaacagtgctaca
ctgggctggctaaaaccactcagggatggaggtgccaaaatcaatggttatgtggtggat
taccaggaggagggtgcacctgaggacaaatggacaccatattctgtggtcaaagacctg
actatcgtggtagttggtctgaaagaaggaaagaagtataagttcagagtggctgctagg
aactcagtgggagtcagtttggctcgagaggctgagggaatgtttgaagttaaggagcag
ctcatggctccaaagataatcatgcctgacattgtgacagtcagagctggatccaagatg
acgattgaggctattgtggcaggtaaacctgctcccgtctgcaagtggaagcagggcaat
gaggatgtgctgacctctgatcgcctgtccattgtaaagacgctgacaactaccacactt
attataaagaatgtaacaagaaaggatagtggttactacagcctgtcagctgagaacagt
actgccaagattaatcagatcctcaaagtcatcgtcatggacatccctggaccccctgaa
gctcctttggagatcactgaactggacatagatgcgtgcacactgctctggaactcgcca
caggaggatggtggtagcaacatcaccaactacattgtagagaagtgtgatgttagccag
ggtgattgggtcaccatttctacatcttgcacaaagacgagcttcagaatgaccaaactg
acacctggcaaagagtacagcttccgtgttcgtgctgaaaacaggtttggcgtctctgag
cctacctactctgagaggatgattgccagatatccatttgatcctccgagtgaacccaga
aacctgcagataaacaaggtcaacaaggatttcgtcatcctatcatgggagcgtcccagc
actgatggtgggagccccatcactggatattgcattgaaaagaaggagaggaatagcctt
ctgtgggtaaaggctaatgagactctggtcaaagccactcagtacacctgcacaggcctg
attgaaggcctggagtacagcttcagggtgtcagcacaaaaccaggctggacagggcaaa
ccttgtaaacagacagacttcatcactgccaggactgctgtcgacccaccaggaaaaccc
gagcccatggatgtgaccaagaacactgtatcattagtgtggggccgtccaaagcatgac
ggtggcagcaagttgattggctactacgtggaatacacaaagcttccagaagagaagtgg
actcgctgcaatgccaactgcatgaacatccagacagagaactatgtggtgactaaccta
gaggagggtcaacaataccagtttagagtcatcgccaagaccgcaattaacatcagcctt
ccatccgagctatctgaccctattcctgtcatcgcagagaatgttgctcctcgtgtggaa
gtgggtgttaacatgaaaaacctgattgtggtgaaagctggagaaaatgtcttcctggat
gctgaggtctttggcaaaccacttcccaaagtgagctggaagaaggatggagtacctctg
gtccttgctgagggaatgaagatgtcacaaaagaaacatgttcatctgctggagctatac
tctgtcaccaggaaagagactggggactacactatcacagctgaaaatgtcaatggcacc
aagtacgccaccataaaggtcaaagtactcgacaaaccaggccctccagcctcagtgaaa
attactaaggtgtttgctgaccgtgttaagctgcgatgggagccaccacttgcagatggc
ggttctgaaatcactaactacatcattgagaagcgtgagactagcagggccaactgggca
ctggtcacctcaaacatccatggacacatcactgactgttcagtggagaagcttattgaa
ggacatgaatatcagttccgagtcagtgctgagaaccagtatggtgtgggagatcccatt
atgactgacggtgtcacggtcaagaatccttatgatgttcctggtccatgtgagccacct
gtcatcaccaacatcacaaagaactccatgacagtcagctggaaggctccagccaatgat
ggcaagtctcccatccttggctacatgttggagaaacgtgaggccactgagctgagctgg
gctaaggttaaccgccgaccagtcattgataggaccattaaggccactcaactgactgag
ggctctgaatatgagttcagagtaattgctataaacaaggctggtcttgggaaacccagc
gacgcttcaaatggtgccctggctgttgaccctgtctatcctcccgggccacctgccttc
cccaaggtggtggactctaccaagacgtcaattagccttagctggaccaaaccagcatat
gatggtggctgtgagatcattggatacttggttgaatgcaagcgagttgatgcagagagc
tggacaagatgcaatgtgccaaagaaactccaggccacaaaattcttgctgacaggcctg
atggacaacactgagtaccagttcagagtcacggctgttaacaagattggctacagtgag
cccagcgaggtgcctggaaactacatgcctaaggatatcctaattgctcctgaagctgag
cttgacgctgacctgagaaaagctttggttctgcgagctggagtaaccatgaggctctat
gtaccactgagaggacgcccagcaccgaaggtgacatggactaaagttgatgctaatttg
aaggaaaggcaaggactactgatcaagacatcggactgggacaccctactgatgattgag
gatgttaacagatatgattctggcaaatatgttctgtcactggagaacagcagtggctct
aagagctacaccatcgtagtaaaggtccttgattctccaggcccacccttaaacctgact
gtgaaggaaacctccagaacccatgcctgcatcacctgggatgccccactgattgatggt
ggtagtccagttaagaactacatcgtagagaaacgtttggctgagaggaaagcctggacc
tgtgtgtcagcagattgtcctaagatttccttcaggatcaccaacctggaggcaggacag
gcctactgcttcagagttctagctgaaaatgcatacggcattggagaaggctgtgagacc
ccaggcagcatcagggcctctgagcaacctggtccagtgacagacttcaaagctcagaag
actacaaagaactctatcaccctgtcctggaagaagccaatcaatgatggtggaagttat
attactgcatacatcttggagcagggtgaaggcgaggagaagtggaagcagatcgtgaaa
ggcaagaatacctcacacactattggagaactgacagaaggcaaggagtattctttcagg
gtcaaggcactcaacgagtctggagagggaccacccactgagctcactgctgttgcaaag
gaccaatttgtgctacccaactgcaacttaagcaatctgcacgatggctgctgtgtggtt
aaggagggcagcacaacacgcattaacatccccatcactggagttccaaaccccactgct
acctggaagaagggcgatatgggactgggtgatactggccggatgtgtgttgaagcatct
cagggtatcaccaccttactgattcgagactgccagagaggagatgctgacacctacact
ataaacgtcaggaacagtgctggctcaaaggactgcaagttccagctgaaggtggttggc
aaacccggtatctgcactggacccattacatttgatgagataactgccgatgccatcaca
ctagagtggggaccacccaaagatgatggtggtgcagaggtgtctaattacattgtggag
aagaggagaacaacagataacaagtgggctacagtggcttctgccatccagaagaccacc
atgagagtgatcagactccacgaagggatagaatacatctttagagtgttcgctgagaac
aagtatggggttggagaacatctgaggtctgacccagtcgttgcccagcatcccttcaat
gttcccggggcacctgctccaccagaaattgtgagcatcaggcatgaatcagccatcttg
acttgggttgatccaaaggacactggcggtgccccagttactggatatcacatagagtat
aaggaaaagaacagtctgatgtggaagcgggcaagtaagactcctctgagagtaaaagaa
tgtagagtcactggactgacagaaggattagaatatgagttcagggtaatggccatgaac
atggctggcctgggaaaggctagcaaagtcactgaggccgtggttgccctggatcctatt
gatcctcctggcaagcctgaagtaatcagtatcaccaggagcacagtcactctgatgtgg
acagctcccaaatatgacggtggctacaagcttactggttatatcatagagaaacttgag
gccagtggtaaggcctggatgaaagcaaatcatgtcaacattcagggctgtgcttttacc
gtcactgacctgactgaaggatcccagtatgaatttagagtcagagccaggaatgctgca
ggtgccatcagtattccttcagagcctactccgcttttgacctgcaaggatgaatatgag
cctccaaccatcactattgacccagaaatgaaagatggtatagccatcagagcaggagac
acaattgtaatctcagcttctaaaattgtgggcaaacctccacctactgcagcgtggtcc
aagggaggacgtgagttgaagacttctgacattgtcaccatcaccagtaccccaacctcc
tctactctggctattaagtacgcaagtcggaagaacacaggggagtacactatcactgcc
agcaacccctttggcattaaggaagaacatgttaaggtgaaggtcttagatgttcctgga
cctccaggcccgattgaagccagtaacatttcagccgaaaagtgtaccctgacctggctt
ccaccggaggaggatggaggctcttctatcaaatcctacatccttgagaagagagaaacc
agccgactacagtggaccaaactagctgaaaatgtcgtggattgcagacacgtagtcagc
aaactgattaaaggcaacgaatacattttcagagtgtctgctgtgaaccagtatggcaca
ggagattcaacccagtctggtccagtcaaaatggttgatagtttctccccaccaggtccg
ccctcaaccccagacattgataatgttagtaggaatgctgtcaccatttcatggaagaga
ccagtacgagatgggggaagtgacattagaggatactgtgttgagaggaaagaaagaaaa
ggactgagatgggtcagagcctgtaagcggactatccctgacctgcggtttaaggtgcaa
ggcctgagtgagggagtagagtacgagtttagagtcactgctgagaacaaggctggattt
ggggagccaagtgaaccatcgcgccctgtcatgacaaaagatattgtgtatccacccggt
cccccatccaaccctagaattacagaaaccaccaaaacctcagccacattcacctggggc
cgaccccactatgatggtggtcttgaagtagagggctacattgttgaatataaaaaggaa
ggacatgatgattgggagacagagacacagtacccactgaaagcttcagaatacgtgatt
ggtaaacttcaaaaaggaggcaaataccacttcagggttagtgctgtaaactctgaggga
ataggcgagcctgcggaggttgagaaagtgactgaattggtggaccaggagatgttgcca
gactttgagctggatgctgaactcagaagaactctggtagttagggttcgtgcttcaatc
cgtatgtttgttcctatcaagggccgtcctgtccctgaagtcacatggagtaaagatgat
actaacctgaaaacacgtgcacatattgacaccacagagtcatacactcttctggttatt
cctgactgcacaagatatgatgctggaaagtaccacctttgtctagagaatgttgctgga
aagaagactgggtttgttaatgtgaaagttctggatacaccaggaccaccagtcaatctc
aaacctagagagatcgcgaagaacagcatcaccctacagtgggaaattcccattattgac
ggtggttctaagattcgtaactacattattgagaaaagagcagccactaagaaggcctac
acagtgcttagcaccacatggcagaagtgttccttcaagattccagacctcgaggaggga
gcttactactatttccgtgtctcagctgagaatgacctgggtgtgggtgagccagctgaa
accccagagccaatcagggtatcccaggccccctctgccccagaaaatttgtatgtcacc
gatgttacctctgatagtgccagccttgcatggaccaagcctttacatgatggtggcagc
ttgatcactgggtatgtcattgaggctcaaaagaaggacactgatcagtgggtccatgtg
gccaccattaaggctctggattatactgttacagatctaattgagggtgctgaatatacc
ttccgtataatggcagtcaatgcatcaggcaggagtgatccccgtgagagcagaccagct
gttatcaaagagcagacttctgctccttcatttgacctgcgtggggtctaccagaaaacg
atcattgctaaggcaggagatcggttgaaggtggagattccagtgttgggcaaaccaagg
cctgtagtttcatggaagaaaggagatacagtggtcaaggagacacaaagactcaacatt
gaaactacactaacatcaactattctcaacatcaatgagataaaaaggacagatggaggc
cagtattctatgactggtaaaaacatgctggggacaatgacagagacaatcacaatcctg
gttcatgacattcctggacctccaactggtcctattaagctggaagaaatttcatgtgat
tatgtgctgatgtcctgggacccaccagaaaatgatggaggtgttcctattaacaactat
attgttgagatgcgggagaccactggtacttcatgggtagagctggcagctacagtcatc
cgcaccacatttaaggcagccagactcactactggaactcagtatcagttccgcatcaag
gcccagaacagatatgggattggaccaagcattatctctgaaccagtggtagctgtctat
ccatttgatgtaccaagccagcctggcactcccgtggtcacctctttcaacaaggatgct
atgacccttagttggaatgagccatcctctgatggaggtagtgccattctgggctatcat
gtggaaaggaaagagaaaaacagtattctgtggcagaggatcagcaaagcccttgttgtt
ggaaatctatttaaatcaacaggccttattgatggaattgcatatgaacaccgtgttatt
gctgaaaatatggctggtctcagcaaagccagcaaaccctctgagcccatgtatgctttg
gacccagttgatccaccaggcaggccagtagcactaaatattactaggcatgaagtgacc
ttgtcatggaccaagccagagggagatggaggattttctattactggatacactgtagag
aggagggagatgcccaatggacgttggctcaaagcaaacttcaacaacattctggaaact
atctacacagtcagtggtctaactgaagatgcaacctatgaattccgtgtgtttgctagg
aactcagctggtgctgttagtgctccatcccagtcatctgaagcaatcttgtgcagagat
gacattgaagagccccggcttgatgtagatgcatcatatagcagcactgttgttgtcatg
gcaggagaggtattcaagctggaagccagtgtaactggaaggccaatcccatctctggta
tggaccaaagaaggaaaagagcttgaggatacagccaaaattgagataaaaacatccgag
ttccacacaactttaacaaacaaagattcgctcaggagggatggtggtgctttcactttg
attgcgagcaatcctggtggctttgctaagttcatatacaatgtcaaggtgttagataga
ccaggacctcccaactccctcactgtaacagatgttactgctgagaaatgtgtccttaat
tggctccatccaacacatgatggtggtgccaagattgagtactttatcattcagagacga
gagaccagcaggttggcttggacaaatgtggccacagaccttcaagctaataggttcaag
gtcaccaagcttctaaagggcaatgaatacattttcagagttatggctgttaacaagtat
ggtgtgggtgaacctgtggagtcggaacctgtcatctgtgccaacccctatgtacccagt
gacccaccacagcagcctgaagtcaccataatcaccaaggactctatggttgtctgctgg
gatcgccctgaacatgatggtggcagtagaataaacacatacataattgaaagacgggac
aaaactggcctgcgctgggtgaagtgcaacaagaggactgtaactgacttgcgattcaaa
gtctcaggcctcacaccagggcatgaatatgaattcagagttcttgctgagaataatgct
gggctaagtcagcccagtccttccagtccattctacaaagccattgacaccatcttccaa
cctggacctccagggaaccccagagtgctggacacaaccaagtcttctatcacacttgca
tggaacaagcctgtctatgatggtggctcagaaatcactggttacatagtggagacctgc
ctgcctgaggaggatgaatggacaattcacactcccaagaatggttggacagccacttct
ttcaccatcaccaatttgagggaaaaccaagagtataaaatcaatatttctgccactaat
tgtgaaggagtgggagagcctgcagctgttcctggaacacccaaggctgaagacagacta
gttcctccagaaattgaacttggagcagaactacgtaaggtggtctgcatcagagcctgc
agcacactcagactttttgtccctatcaagggaagaccagcacctgaaataaaatggtct
agagagcatggagaatctctagataaagctaacattgaaatcacctcatcattcaccact
cttcaggtagaaaatgttgacagattcgatgggggtaaatacattgtgactgtagagaat
gcctcaggaagtaagacagcctttgttaatgtcagagtgctagacagtcctggagcgcct
caaaatctgattgtcagggaggtcactagagattcagtttctcttgcttgggatgctcct
gtcattgatggtggttccagagtccgcaattacattgtggagaagcgtgaatcaaccaga
aaggcttattcaactgtgtgtgccagctgccataagtcaagttggaaagttggagaccta
gaggagggaaagatgtacttcttcagaattttggctgaaaatgaatatggcattggcctc
ccagtagagactcttgaaccaattaaagcatcagagaggcctcttcccccaggcaaagtg
tctcttcgtgaagttaccagcaaaagtgtcacattaagttgggaaaagcctgaccatgac
ggtggaagcagaatcactggctatatagttgagatgcagggaaaaggcagtgagaagtgg
acccaggtcatggttgtaaaaagcaatgaagctcatgttactggccttacacagggagaa
gagtatacattccgtatttcagccgttaatgaaaagggagccagtgacccccgctctctc
aatgtacctgtggttgccaaggatctggtcatctcaccaaccttcaaacttcttttcagc
acatttagtgtgctagcaggggatgatctgaaaatagatgtaccatatgctgcccatccc
aaggctacagcaacttggctcaaagatggtgttgctctcaaagagacgacaagagtgaat
gcagataccacagacaaaaatcttctcctggttattaaggaggcttgcagagatgatgtg
ggaacatatactgtcaaacttactaacacagctggagaggcatctacagatatcagtgtt
attgttttagataagcctggacctccaactggcccaattaagctagatgaggtcactgct
gatagcgtgatcctgtcctgggatccacctcagtatgatggcggttgtgccatcaataat
tacatcgttgagaagagagacacatctaccactaactggcagattgtgtcagctacagta
gccagaaccactatcaaggcagcacgtctgaaaactggatctgagtaccaattcaggatt
gctgcagagaacagatatggcaaatcttcagccctgttatctgatactattgttgctcag
tatccttttgaggttcctagttcaccacgttctgttaccgttcagtcaaccaccaaggaa
agtatggtggttgtatgggaaaaacccagcaatgatggtggaagcaagattttgggatac
catttagagctaaaagagagaaacaatatattgtgggtgaaacagaacaaacaacttgtc
ccagaaacaagattcaaggttattggcctggaggagggtattgaatatgagttcagagtt
tatgctgagaacattgttggcctcagcaaagccagcaaagtgagtgaaatacaagttgcc
cgagatccttgtgacagaccaggaaaaccagaagctgtcattgtaacacgaaaccaagtg
acactaagatggacaaaaccccaatatgatggtggaatcaagatcacaggttatattatt
gagaagaaggagggagctggtcggtggatgaaggccagtttcaccaacatcactgaaaca
gaatttgttgtcacaggacttattgagaatcagatttatgaattccgtgtcattgccaaa
aatgcagcaggtgtttttagccagccatctgattctactggagccatcactgccaaggat
gaggtggatccacccaaaattgacttggaagctaaatactcccaagctgtggtagttaat
gctggagagacatttaaacttgaggctactgtttatggtaaacccgtacccacaattcac
tggctgaaagagggccaggagatcaccgaagcagctcgcttagagcttaagaacacagat
tttacagcttgtctggttgttaaagaagccatccgtgttgatggaggtcagtacatactt
ctagtaaagaatgttggaggagagaaatctgttaacattaatgttaaggttttagacaga
cctggtgcacccgaaggccctatatccatttatggtgtcactaatgaaaaatgctcaatt
tcctggaaacctcccttgcaagatggaggaagtgatgtttcccattatactgttgagagg
agggaaaccagcagattggtttggactgtagttgaaccaaaagttcagacactgaacttg
aagatcaccaaattacttcctggtaatgaatatattttcagagtgattcctgttaacaaa
tatggagttggagagccactggaatctgagccaatggttgccaggaatccatttgtcact
cccaacccaccaacaaatgtggaagtttccacaatcaccaaagactctatggtggtgacc
tgggagagaccaactaatgatggtggcagcccaatccagggatacattgttgagaaacgt
gacaaggatggtgtgcgatggactagatgcaacaagcgcaatattagtgagctgcgcttt
agagtaacagggcttcttgaaaaccatagctatgaattcagagttgctgctgagaatgct
gcaggtgttggcatgcctagtgcaccaacagtgtactacaaagcactggatcctgtcttc
aaaccaggcccaccaaacaaccccaaggtggtagacacatctagatccactgtttcccta
acatggggcaaacccatctatgacggtggctgcgaggttcagtcttacattgtagaggca
tgcaatggtgcatctgatgagtggtttatgtgtactccaccaactggaatcatggacaca
aaatatactgtgaaaaaacttctggaaaagcatgagtaccaatttagagtgtgtgcaatc
aacaaggttggtgttggtgagcatgctgatgttcctggaaaaattcttttggaggagaaa
cttgaagcacctgatcttgatcttgatgcagatatgagaaagatgatcaacatcagagca
gcaagtacgctcagattgtttgttcctgtaaggggtcgtccagctccggaggtgaaatgg
ggcaaggctgatggtgagattaaggagactgctcagattgacaatacaggcagctatgca
tcacttgtcattgagaatgttgacagatttgatagtggcaagtacaccctgactgctgag
aatgctagtggagtaaaatcagtcttcataagtgtcagagtcctggactcccctagtcca
ccaactaacttcgtggtgaaagagattaccaagaattctgtcactctcacatgggagcct
ccacatctggatggtggctcaaagattaagtactacattgttgaaaagcgtgagagcacc
aggaaagtgtactctcccatcactacatgtaacaagatgtcatggaaagttgaacctctt
ccagagggtggaatctttttctttagagtattggctgagaatgaatatggtgtgggtctc
cctgctaaaactatagaaccagttaagatatctgagaaacctcagccacccggcaaggtc
agtgttgttgacgttactcacagcactgtaactttaacttgggaaaagcctctgcacgac
ggtggtagtagaatcacccactatgaagttgaactagctcccaaggacagtgaaacttgg
tctatatgtgctagtgtgaaagcactggaaacattagtgacaaaccttctcaagggagag
gagtaccagttcagagttgttgctgtaaatgacaagggcaaaagtgacccgcgacagttg
gctcattcagttatagcaaaggaccttgttattgaacctgctgttagacccaaggcaagt
tcttatagtgtccaggtggggtatgacctcaagatagatgtcccagtcgctggtcaccct
aaaccaattatcacctggaccaaagatggcgtagcccttaagcagactaccagagtcaat
gtcaccgactcagcacaaactaccactcttaccataaaggatgctaccagagaagatgga
ggtatgtacactatcagtgtctccaatgaccttggttcaaagaatgcaactgtagaggtg
atcaccttggacaaaccaggcccacccacaggccctgtaaagttggaggatatcagtgct
gagagcatcaccctcagctgggaacctcctacatacacaggtggttgtccaatctcaaac
tatgtggtggagaagagagacacaaccacaacaaactggtcggttgtgtctgccactgtg
gctagaaccactctaaaagtcagcaatctgaagacaggcactgagtaccagttcagaatt
tatgctgaaaatagatatggaaagagctatgcaattgattcacagcctgttgtggcacag
tatccattccaggagccaggaccaccaggaacaccatttgtttcttcatacactaaagac
tacatggtagttgagtggcataaacccccaagtgatggtggcagtgccatcttgggctac
catctggaaaggaaagaaaggaacagtatcctctggacaaagataaacaaaatgctcatc
caagattgtagattcaaatctactccactcgaggaaggcattgagtatgagtatagagtc
tatgcagagaacattgttggcattggtgagtgtagcaaagtgtctgaggtttatgttgcc
cgtgatccatgtgatcctcctagccgtcctgaggctgtgattgtgaccaggcactcagtg
aaactcaagtggaaccccccagagtacgatggtgggagtttagttacaggttatctagta
gagaaacgtgatcttcctgaaggaaaatggatgaaggctagcttcacaaacatcattgaa
catgaattcacagttactggcctgacagaagatagcaaatatgacttcagagtaattgca
aagaatgctgcaggtgccgttagcaagccctctgagagcacagggtccataactgctaag
gatgaagttgtcccacctaagagtgagacagatcctatgtacaaccagaccattgtcata
aatgcaggagagacattcaatcttgaggccagtgtggaaggaaagcctattccaactgct
cagtggttcaaggggaatcttgaagttgaaaactcagcaagagtggagatcagaaacaca
gattttaaagctttgcttgttgtaaaggatgctatcagagttgatggtggacagtatact
ctggttctcacaaatgtggcaggaagtaagactatccccttcagtgtgaaggttctggac
agaccagggccttcagaaggacctcttactatcagcaatgttactgaggaaaaatgctca
ctgtcatggctgccacccaggcatgacggaggcgccagcatttctcactacatcatccag
aaaagagaaactagccgcttggcatggactgtggtctgcagtgattgtaaagctaccatg
tttaaagttacaaagctactgaagggaaatgagtacatcttcagagtcatggctgtcaac
aaatatggcacaggtgagccgcttgaatcagcaccagttatcatgagaaatccatttgtt
ccacctggcgcacctcaggatcttgagatcacaaacatcaccagggattctatgactgta
tgttggagccgtcctgagacatcaggaggcagtgacattgttggctacattgttgagaaa
agagacagagcaggagtgaggtggaccaagtgcaacaaacgcagagtgacagacttgcgt
ttcagagtaacaggactgactgaggaccatgaatatgaattcaggatatctgctgagaat
gcagctggagtgggccagccaagtccatcgacaccctatcttaaggcatgtgaccccacc
tttgagccaggctgtcccaccaatgtccatgtggtagacactactagagactccattagt
ctggcttggcacagacctatctatgatggtggctgtgagattcaaggctacgctgtggaa
ataaccaaggctgatgaggaggaatgggccatatgcaccccaccttgtggagtcaatgct
accaagtttaccatcaaaaagttgattgaacaccaagaatacaaggtccgcatttgtgcc
atcaacaaggtgggtgttggtgagcccactgagatccagggagtcgttaaacctatggat
aagattgaccctccagaagtgattctggattcagagctcagaaagggaatagttgtccgt
gcaggaggctcgatgagagtctgcattccattcaaaggccgtcctactcctgagataaac
tgggccaaagaggatggagagctacccagtaaagttcagattgagactggtgaagattac
acacagctctcaattgaaatctgtgacaaatatgatgctggaaagtacgtgctcaattta
gaaaatagtgctggcaccaaatcagcttttgtttccgttaaggtgctagacactccaggg
gctcctttaaacctaacagtaacagacatcaagagggaaagtgtgactctgacctgggag
cctcctcttattgatggtggtgcaagaatcaagaattaccttgttgaaaagagggagtcc
acaaggaaggtttactctaatgtggacaacaagtgcacaaagacaagctatcgtataact
ggcctgacagagggaactatatattatttcagagtcttagcagagaatgagtttggtgtg
ggacagccagctgagacagaagaatcagtaaaaacatctgagccccccctgcctgtgggt
aaggtcacgttgaccgaagtgacaaaaacaactgcttcactctcctgggagaagccagat
tatgatggaggtagcagaatcattggttactacattgagatgcagcctgtgggctcagag
gaatgggtggtagctgccacatgcaaaacttgtgaaggcactgtcacaggcctcagtgca
ggacacgagtacctatttagaatcttagccttcaatgagaagggcaagagtgaccctaga
cctttggctgcgccagtcactgctaaagatataaccattgaacccaaattcaagattcaa
tttaacacttatagtttacagcacggtgaggatttgaagattgagattccagtgattgga
cgacctgttcccaaggttgaatggaagaaggatggacaagctcttaaagagacaacaaga
attaatgtttccagcacattgtcatgcactaagctgtacatcaaagatgcaaataaggag
gactctggcaaatacactgtcacagccaccagtagcattggaacagctacagaggagatt
actgttattattcttgataagcctgggccacccacaggccctgtgaagatagaagaggta
agctctaattatatcactctgtcttgggagccaccagagtataccggaggctgtcccatc
aataattacatcgtggagaagagagatactaccaccacagcatggcagattgtttctgct
actattgccaggacaaccatcaaagtcaccaagttgaagactggtgttgaatatcaattc
agagtgtcagctgaaaataggtacgggaagagttctgcaattgtctctcctgctgttatt
gctcagtatccatttaatgagcctgctgccccaggaacaccagtcatttcttctgtaacc
aaggatagcatggttgttgaatggaaacctcctaccaacaatgggggcagtccaattctt
ggctatcaccttgagagaaaagaaaagaatagcctcttgtggactaaattaaacaagctt
ctaatcccagacacacgtttcaaaactacagaacttgaagaaggtattgagtatgaattc
agggtttatgctgaaaatattgctggtctcagcccagctagcaagctgtctgagagcaca
gtagcaagggacccttgtgacccaccaggaactcctgagcctattgaaatcaccagaaac
catgtgacactccagtggaccaagccccagtatgatggagggagtgcaattactggctat
gtgattgagagaaggaagcacccagacacccgctggatgaaggccagcttcactaacatc
attgatacacaatttacacttactgctctgactgaagactgtgtgtatgagttcagggtc
attgccagaaatgctgctgggattttgagcaaaccctctcagagcacaggggaaattact
gccaaagatgaaattgaggctccagcagccaccatggattcaaaattcaaggatctgact
attgttcacgcaggtgagacatttgtcattgatgctgactatactggaaagcctttgcct
gaggtcatttggttaaaggatggaaaagagatagacaaagccacaccaagaatggaaatc
aagactacactcacacgtaccatcctgacggtcaaggattgcatcagagtggatggtggc
cactttgtcctcaagcttattaatgtgggaggagtcaagatgatcccagttaatgtcaaa
gttctggatagacctgggcctccagatggacctctagaagtcaaaggggtcacagctgag
aaatgttatctgcattggaatcatccctcacatgacggtggagctggcatctctcactat
atcattgagaagagagagactagtcgtttgtcatggactgtggttgagcccaagattcag
gcaatcagctacaaaatcacaaaactattgcctggcaatgaatatatctttcgagttact
gctgtaaataaatatggtgttggcgagcctttagaatcagaagctgttgttgctcgtaac
cctttcaccactcccagtgccccctcaacccctgaggtcggtgccatcactaaggactcc
atggtgctttcctgggagaggcccaatgataatggaggtgcagagattgagggatatgtc
cttgaaaagcgtgataaagatggtatcagatggactaaatgcaacaagaagaggctgaat
gacctgcgattcagatgcactggtctcacagagggccactcttatgaattcagggtttcg
gctgaaaatgctgctggtgtaggaaagcctagtgcaccaactccgtacatcaaggcctgt
gatgccacttatccacctggacccccaaataatccaaaggtcactgaccattcaagcacc
acagtttccctttcatggtccaggcctatatatgatggtggtgcacagatcactgggtat
attatcgaaatgaaagaggcaacagatgatgaatggatcatttgcacaccacacactggc
atccaagccactaactacacagtaaagaaacttaaggagaatgtggagtacaacttccgc
ataagtgctgttaactgtgagggagtaggagaacatgtagatttgccttgttccgtgatt
gctgcagagaagctggaggctcctgaaattgaattagattgtgacctaagaaagatggtc
aacgtccgtgcctctgctaccttgcgtctgtttgtgacaaccagagggaagcctgagcct
gaggtcagatggtcaaaggctgatggcacactaaatgaacgtgcccagatagaagtcaca
agctcttacacaatgctggtgattgagaatgttgacagatttgacactggcaaatatgta
ctgacccttgaaaacctcagtggctctaaatcagcctttattaatgtcagagttctggat
tctcctagtgctcctactaacctcgaagttaaggatgttaaaagaaattctgtctctctc
tcctgggagcctcctctaattgatggtggggctaagatatcccattatatagtggagaag
agagaacagaagagaatggctttcaccagtgtttgcactaactgcgtaagaaattcctac
attatttcagacctgcaggaaggaggccgatactatttccgtgtgttagctgtgaatgaa
ctcggagtaggtctgcctgcatccacagatcaagttaaggtgtctgagcctcctctgcct
cctggtaagattgtggtggttgacattactcgtcatgctgttacactctcctgggagaaa
cctgatcatgatggaggcagtaagattacaaactatattgtggagatgcagcccaaggga
gatgacaaatggacgatgtgcagtgaagtcaaagcactggaagctaccattgatggactc
acaactggagaggaatactccttcagggtaactgctgtgaatgataagggtagaagcgat
gctaagcctctggctactcctgtggtggtaagggacatcacgatggagcccatcatcaac
ctcttattcaccacatacagtgtaaaagcaggagacgatttgaagattgacgttcccttc
agaggcagaccacagcctgaggtgtgctggaagaaggatggccacatgcttaagcagaca
accagggtaaatgttcttaattcaaaaacctcatctaagattgtcattaaggatgccacg
aaggaggatgtagggaagtatgtgattaccctgactaactcagttggtaccaagtcagct
gaaatctctgttataatcctggataaacctggaccacctagtaacattaaggttgatgag
gtgagcgctgactttatttctctgtcttgggatcctccaacctatgatggtggttgtcag
attaacaactatgtagttgagaagagagacactactactacaacatggcaaatcgtgtca
gccacagtggccagaacatcaataaaggtttctcgacttactcaggggacagagtaccag
ttccgcattgcagctgagaaccgttatgggaagagtcctgccatagattctgctcctgtt
gttgctcagtatccatttgagcctcctggccctccaaccaaacttcatgttgtccatgcc
accaaaactgggatgctcgtggtatggggcaaacctgcaagtgatggtggaagtcctgtt
attggttatcacattgaaagcaaagaccaaagcagcatcttgtggaccaaggtcaacaga
ggcctggtgactgagaaccagtttaagatgacaggaatggaagaaggtctgttgtatcag
ttcagagtgtatgctgagaatattgctggaattggtccatgcactagggcaagtgatcct
gtggcagccagggatccatgtgaagctccacataaccttagagtcacaaacatcactaga
aactcagtttctctttattgggaaagacctgaatatgttggcagtgcaaaaattactggc
tacattgttgagcgtcaagagcttcccaatggtcgctggctaaaatgcaacttcaccaat
attcaagacacttacttcgatgtcactggtctcacagaagatgtccgatatgatttccgt
gttattgctaaaaattctgctgagcaattgagtgctccttcagaaagcactggacccgtc
actgtcaaggatgatgtagaccctcccaccattatactggaagataaattcagacagttg
gttgtcattaaggctggagaaatcattagagttgatgccgaaattactgggcgtccactc
ccagttgtatcatggtctaaggatggaaaggagattgaggccaaggccagatgtgaaatc
acatccactaacttcacaactacactcattgtcaaagatgctatcagaagggactctgga
cagtatgttcttacactgcacaatgtagctggaaccagatctgtggctatcaactgtaag
gttctggacagacctggacctgcctcaggacctttaacagtttctggtctcacagcagag
aaatgcaccctgtcatggggaccacctcaggaaaatggtggtgctgaaattatgcactac
attgttgagaaacgtgagaccagtcgtcttgcctggactcttgtctatggtgacatgaag
gcaactacctgcaaagtgactaaactgctcaaaggaaatgagtacatcttccgagttagg
ggagtcaacaaatatggagatggtgaaagcctggagagtgagccaacaaaggccactgat
ccattcactgtcccttcagctcccactaatgtccaggtcacctctgttacaagtgaggca
atgaccatttgctgggaaagacctgtttctgatggtggcagcagtatcgctggctatgta
attgagaagcgagagaagactggcctccgctggtgccgtgtcaacaagaaacctgtttat
gaccttagagtgaaagcttcacaccttcgcgagggctgtgagtacgaatacagagttttt
gcagagaatgctgctggcctcagtgctcctagcactccttgcccactcaccagggcagaa
gacccacagtttttaccctcacctccagctaagcctaggataattgactccacaaagact
acagtcaccctgtcatggaataagccactttttgatggtggagcacctgtgactggttac
agagtagaatacaggaggacattagatgatgaatggattgttggagtacagaacaccaaa
aacacagaatttacagtggtgggattgtcgcctggagctgaatatgtgtttgttgtcaaa
tccattaacaagattggagtgagtgagcccagtcctgagtcagacaaacaagttgccaaa
gaaagagaggaggagccaacctttgatgttagcaatgaaatgagaaagactcttattgta
aaggatggaagctctttcacaatgaaagttcctttcaaaggcaaacccatccctagtgtt
acttgggctaaggctgatgtagaccttagagttcgtgctgtaattgacaccacagatacc
tttacttccatcaccttagaaaaagcaactcggaatgactctggaaaatacactgtcact
ctatccaatatagctggtacctcctccttgacgctcactgtccgagttttggactcacct
gggcctcctagtcatatagaggtcaaggaagtcacaaagacctctgctactataacctgg
gatactcctgagattgaaggaggaggaccagtcaagaattaccttattgattaccgtgag
gctagcaagaaaggctggactagattgactgacacatgccacagactgacatacaaggtg
gcagacctgcaggagggaggagtctactacttcagagtgacaggcgagaatgaatatggt
attggtgttcctgctgagaccaaagaggggaccaagatcacagaaaaaccaagtccacca
ccaaaactgggtgtaacggatgtaaccaaggaaagtgtgtccttggcctgggccaagcca
gaacacgatggaggcagcagaattactagctacctagtagaagcactggagaatggacaa
gagaagtgggttaaatgtggtacaacaaagtccatccacttcacagtgtctggtctgagg
gagaatgcggagtacttcttcagagtcagagctgagaactatgctggattcagtgatgct
aaggaaatgactactcctgtagtagtcaaagaccagcttgaatctcctgagatcaacatg
aaggacttcccccacaacacagtatatgttagagctggatctaccctaaaatgtgagatt
ccattgacaggccggcctttacctaaagtgactctgtccaaggataatgtgctgctcaaa
tcaacaatgaggtttaactcagaagtcactcctgacagcatcaagattactctgcgtgag
agcattgcaggagactcaggccgctatgatatcattgcctccaactccagtggaaccacc
aagtcctttgtaaatatagtggttcttgaccgccccagtgtcccacttggaccagtggag
ctgtatgatgtcacagaagacagtgtgagcttaaagtggctcccaccagcatatgatggt
ggcagtcccatcaccaattacatcatccagaagcgagagacaactacagccaactggatg
gacgtgtcttccgctgtggcccgctgcaccatgaaaattatgaagctgaccactggcctg
gagtaccaattcagaattagggcagagaacagatatggaatcagtgaacatattgactca
ccagctgtcactgtcagtcttccttacactataccagatgcaccatcaactccagaaatt
actgctgtaaccagggaaagcattactgttgcatggaaggagccaaagtcagatggaggc
agccatgtgtttggttaccatctccaaatgaaagacaaaaacagcatcctttggcagaga
gtcaacaaaacagtgatccgtgccacacactttaaagtcaccaacataaatgctggactt
atttatgagttcaaggtagcagcagagaactctgctggaattagtgccttcagcaaggtt
tctgatgctgtattggctattgatgcctgtgagccacccctatacttgcgcataactgac
atcactaagaactccattagtctggcctggcagaagcctgaatatgatggtggatcccca
ataactggttacatgattgagaagagagagggtgttagctccaaatggtctaaagctaac
ctcaccaatatcacagacacccgcttcattgttactggcctcacccaggatgaaacgtat
gagttccgagttatggcaaagaatgcagttggttcagtgagcaacccgtctatcactgtg
ggaccagccacatgtgtggacacttatggtgccccagagattgaaatacctcaggagtat
cttaatgaggtcaagcacaaggctggctctaatgtggaactcaaatttaatataagagcc
aaacctgctcccagtattgagtggtttaaagatggcagagagcttgagcctacttctcag
ctttcttttaaacacactttcgagtccacaagtgtgttcctgaaggaaacaactcgtctt
aactctggaacctatgaagtcaaggtgaagaactccctcggatcgtcatgtgccattgtc
aggctgctcattcaagataagccaggcccacctgctggagaaattcagtttaagaaggtg
acagctgacaacatcaccatcatgtggtccccacctgctgatgaaggtggtgccatggta
acacattacattgtagaaaagcgggagaccagcagggtaatgtggtcgattgtctcagag
aaactggttgactgcattgtgaatgtgcccagactcataaagggcaatgagtacatcttt
agagtccgtggagtcaacaagtatggcattggagagccactggagtctgagcccattatt
gccaagaatgcatttgtacctcccagcgagccatctaagcctaaagttactatgatcact
aagtctaccatgacagtaatctgggaaagaccagcgttggatggaggcagtgatattgat
ggctactatctagagaaaagggagaagaggagtctgcaatggttcaaggtggtgaagggc
actatcagagacaccaggcagaaggtggctaacctggtggagaacaatgagtaccagtac
agagtgtgtgctgtcaacaaggctggagcaggaaactactctgaaccttctgagctctat
aaagcctatgacccaatagatctaccaggtgaacccactaaactgcgtgtgattgattcc
acaaagacatctatcacacttggatgggagaagcccgtctatgatggtggcagcgaaatt
acacactatattttagagcagatgaatacagaggacaaagaatgggtgatttccaaccca
caagtcaagacatgtgagtatgtggtgtcccacctcaaacctggcatctactacttcttc
agagtatctgctgtcaactgtaaaggcaaaggagaagacatcaaaatgtaccagcctgtg
caagccaaagatattttagaggaggctgatctggacttagatgttgctatgacaactcaa
tacacagcaaaggctggccgtgatgtggaagtctttatccccctaaagggtcgtcctaca
ccaaatgtcacctggcgccgtggtgaccgtaacatggctggtgataaccgctacacaatc
acaagcactgaaagagccaccacactcctcatccccaaggtcacccgtgatgactgtgga
aagtatgtgctggaaattgagaatggtgttggagaacctaagatagttactgtttccctt
aaagttctggacagtccatccacctgccagaaactgatgataaagaatgtcacaagagga
aagctgacactaagctgggagcctccgctcatagatggtggctcccctgtgactaattac
attgtcgaaaagaaggcctccactatgaaagcttatcaagtgattactgatgagtgttta
aatacaagttacaaggtgtcagggctggaggaagatatagcttacttcttccgtgtgtct
gctcaaaatgagtttggtgtgggtgacccttgtgaaaccactgatgctgtccgagcaact
gaaactccaggagctgttaaagacctaataatggtggactccacaaagaactctgtcacc
cttcagtggagcagacctgaccacgatggtggcagccacatcactgactacataattgag
aagagagcccaggatgaagtcaaatggactttagctgctaaatgcaagcggtgcagctgt
gaagtgacgggactcaaggaaaatactatcctggattttagagtgtttgcaaagaatgag
aaaggcaacagtgacttctcccaaattggtccgatcacagtgatggacctcatcattcca
cctgaagccaacctgaatgattatcccaatggagagcttgctgttcgtataggtcaaaac
atccatattgagttaccattcaagggaaaaccaagacctacaatcagctggctaaaggat
aatttcccactgaaggaaagtgagaagattcgctttaggaccactgacaacaagacttca
gttacagtcagaggggttaagaaagaacatgctggacaatacaccttggttctggataac
agagtcattaagaactactttgacatcaatgtgatcactctgggacccccttcagtccct
accggccccatccgttttgacgagataaaagctcagactattattatctcctgggatgag
ccgaaggaagatggaggtggcgagatcacctgctacagtgtggagaaacgtgaaacctcc
caggccaactggaagatggtctgctccagtgttgtcaggactacctttaaaattcctaac
ctggtcaaaggaactcagtaccagttcagagtccatgcagagaataagtatggggtcagt
gagccactcatctcttcagatgttgttgcccagcaccagtacaaacctccaggtcctcca
ggaaaaccagttgcctacaacatcaccagtgatggtatgtcaataaagtgggatgcccca
gattttgacgggggttccccagtcttaggttatcatgtcgagaagaaggacaggaacagc
ctcttatggcagaaagtgaattccacaaccatctccaacagagagtacaggataattggt
cttgtggagggtctggagtactcctttagagtctatgcagagaacaatgccggactcagc
ccttgcagtgaacagagcaaacatgcgctcgctatctcccctgttgatccacccggtacc
ccagtctgcattgatgtaaccagagactcagtcaccctccaatgggacattcccaagagg
gatggtggaagcaaaattgtagcctatagtgtggagaggcgtcaaggcagaggcaaatgg
ctacggtgcaacttcactgatatcagtgagacccagttcactgtaactggtctctcacct
ggagacagatttgagttcagagtgattgccaggaatgctgttggcacagtcagcccacca
tccaactcctctggatacataatgaccaaggatgagagcattgttcctgagattgagtgg
tctccagaccaggtgctcaccctgagggctggagataatgtcagtctcagctgcaaaatc
accggacgtccagtcccacaggttctttggtacaaggatggtaaagagatcgacaagagg
actatgattgacattgagattaatactggcattggcaccagtagtctgtttattcgcgat
tctaacaggaaccaccgtggaatttacactgtagaggccaaaaatagctctggaaccaag
aaagctgatgttaacgttagagtccaagatacccctggacccgtcgagggcccaatccgt
ttcacaggcatcacagctgagaagtgcactgtgtggtggagcccaccagagaacgatggc
tgtgctgccattactcactatgtggtggagaaaagggagacatccaggatcacttgggcc
ttggtcacctccaagtgtgaagcttgctcttataatgccaccaacctcatcaaaggcaat
gagtaccagttcagaatctctgctgtcaacaagtttggtgtcggtaaaccactggactct
gatcctataattgcgaagatgcagtacactgttcctgatgcccctggtacaccagatgcc
acccatattactggagacagcataacgctgtgttggaccaggccacggtcagatggaggc
aatgagattaaatactacatcctagagaggagagagaagaagagcttgcgctgggttaag
gtctcctccaagaggcccattacagagttaaggcaccgtgtgaccaaacttactgagggc
aatgagtatgagttccgtgttatggctgaaaatggtgctggtgtcggaccagccagcagc
acctccaggctcttcagatgcagagaaccaacgagtgctcccagtgctcccactgtaatc
aaggtcattgactccactaagtcctctgtcactctggaatggaccaagccagtctttgat
ggtggcatggaaataattggctacaatatagatatgtgtaaggccagtctggaggagtgg
cacagagtcaacagacagatttgtattcacaccaggtatactgtcacaggtctagtacct
ggagaactctacaagttcagagtcagtgctgtaaatggatcaggagagggcgaagcatca
gtgatgccaaaccctgttcagtctttggacagacttacatctcctgaaattgatcttggt
cctgacttcaagcaaactcatattgtgaagaatggaggcactgtaaccctacatattgct
ttcagaggaaagccagctcctctagccacgtggtctaaattagacagtgagcttccgata
atggctgatatcaacaccacagattcattttccactctgaccatagagaactgcaccagg
tatgaggcaggcaaatacaccctgtccctggagaacaacagtgggcgcaaatccatcaca
ttcactgttaaagtactggatactcctggacctccaggagccataaccttcaaagatatt
actcgcggagccttgacagtgatgtgggatgctcctgccaatgacggtggatcccgaatc
caccactacattgtggataagcgtgaagcaagccgccttgcctggcaagaagtcagcacc
aagtgctcacggcagatgatcagagtaactggtctggaaattggtgtaccatatttgttc
agagtgattgccgttaaccattatggccagggagaaccaaaagagatgactgagcctata
attgccacagaagaacctgcgccacccaagagattggatgttgttgacacaaccaattcc
acagcctcactggtatggctaaaacctgagcatgatggaggcagccgcattagaggctat
attgttgaattcagggctaagggcactgagcactgggttgttagtggagagactaagtct
cagaagatggtggtagagggtctgattgagaacacagagtatgactttagagtcaaagcc
aagaatgatgctggaattagcgaacctcagggcacctttagctctgtggtcataaaggag
ccttgcatagaaccaactgctgatctcagcagcatcaccaaccagctcatcacttgcaag
acttccaacaccttcacaattgatgtccctatcagtggcagacctgcacctaaagttacc
tggaaactggaagagatgaagcttaaggagactgacagagtctccattaagacctcaaag
gaaagaaccattttggtagtgaaagacagcaagagaagcgacagcggcaagtactacctg
acactggagaatgctgctggtgtgaagacattcacagtcactgtggtcatagttggcaga
ccaagtccacccacaggaccagtggaaatttctggaatctcttcagagtcctgcacccta
tcttggtctgagccagctgatgatggtggtactgacatcagcaactacattgtagaaaaa
cgggaatctggctccgcttcttggcaagtggtgaactccagtgtgaagagaaccacgatc
aaagtgacacatctcaccaaatacatggagtacacatttagagtctgtgctgagaacaag
ttcggagtcagcaagtccgttgagtctgcccctgttgtcattgagcatccatttgttcca
ccaagtcctccaactcgcccagatgtgatatttatatctgccaatgccattagcattaaa
tgggatgttccatatgctgatggtggcagcaaggtgacaggctactggattgagaaaaag
gagaggaacacgatcctgtgggtaagggagaacaagctaccctgcctggattgccaatac
aaggtctcgaacctgattgaggggctggagtatcagttcagggtgtatgccatgaacctt
gctgggctcagcaaagccagcgaagcctccagacctgtagtggcactcaatcctgttgat
cctcctggcaaacccgaggtgacagacatcacccgctcttctgtgtcattgtgctggacg
gtgcccttcaatgatggtggcagtaagatcattggttacgtggtggagagaaaagtctac
agcacagatgagtgggatgacaaccgctggctcaagtgcaactataccacaatcacagag
aactacttcaccatcacaaacctaggtgaaggagagacctatgaataccgtgtcgctgcc
aagaatgctgctggtgttcaaagtgtcccttcagagaccactggaccagtcacatgcaag
gatgaatattctcctcccaaagctgaacttgacagcaaactgataggtgagattgtcact
gttactgctggttctgaccttgtcttggacggtgctgtgggtggtaaaccagagcctaca
gtgtactggtcaaagggcgacaagattttagagcttggagaaaaatattcactgacctac
actgccaccagagccatggctgtgatcaagagctgtgacagatacgacacaggtagatac
attctaactgtcaagaatgccagtggaattaagacggcagctgtcagcgttaaagttcta
gacactcctggagctccagctgataggattgtaatcagcagagtcacagaggaaaaatgt
acagtgtcttggaagatacctctggaggatggtggagatcctgtcacccattacattgtg
gaacgtcgtgagaccagccgcctcaactgggtcgtcatggagactgagtgcaagaccctg
tcatgtgtcagcactaggttgattaagaacaatgagtacatctttagggttagaggtgtc
aataagtatggggctggagttcctttggaatctgatcccatcatcgccagaaacgcttac
acaatcccctcccagccaggcacaccagaggccactgcagtgggtaaggagcatgttatc
atcgagtggcagaagcctgagagtgatggaggaagcgagctcaaaaactacatagttgaa
aaacgagagaagaacagtagcaggtggactcgagtgaataagacctacaccatctatgac
acccgtctgaagatcacaggcctactggagggaagcgagtaccagttcagagttacggca
gtcaactctgctggatacagccagccaagtgacgcctcagtatacatcctctgtaaagac
cccacatacaccccagctcctccatcagtgcctcgcatcacagacacaacaaaacacagc
atcaccatgacttggaccaggcccatgtatgatggtggatcagatgtcaccggctacgtt
gtggagatcctagaggagggttctgagcagtggtaccgtgccactgccaaagccctcaag
actaatgattatgtggctggtggtttggctgccaataagaagtacagattcagggttgct
gccattaacagcaatgggactggagagttcagtgaaccaagtgctgaagtcgaaccactt
gagaaaattgaaatacctgacttggagctggctgatgacctaaagaaaacagtgtgcctc
cgtgctggaggtactctgcgcctgtttgtgtctgtcactggtcgaccaacgccagtagtg
gcctggagaaagacgggggtggaactacagagccgtggttatattgagactactgacaag
tacacatcactggtagtagagaaggttgatcgctacgactctggaaaatacattgtagag
gcagagaacccatctggaaaaaagactgccaccatccttgttaaagtctatgacactcct
ggtcctccaggttcagtgaaagtgaaagactacaccaaggaatctgttgtgatcacctgg
gatgttccaagcattgatggtggtgctcatgtcagcaactatattatagagaagcgtgag
gccaacatgaagtcctataagactgttaccactgagtgtaggaaaaccctgtacagaatc
actggactggaggaaggtgtgtactactttttcagagtcctgccagagaatatctatggt
gtcggtgagccctgtgagacagcggaggctgtgctggtgtgtgaagtgccctcagtgcct
gtgaagcttcagattgttgatgtttccaaatcttctgtcaccctgcactgggagaagcct
ttgcatgatggtggcagcagattgacaggctacattattgaggcctgcaaagtaggctcc
gacagatggagtgctgtggcgacagttaaggcctcagtgtcccagcacaccatccagtct
ctgacagaaaatgaccagtatctgttcagaatccgagccacgaacagcaggggagccagt
gaatccactgacattgtcactccagtgatcatccaagagatcaaggttatgcccaagatt
gacgtgacaagtatccctcagaagatagttcatgtgcatcgtggcaaacccattgacctc
aacatcccaataaggggcagaccacagccagtctgctcgtggtactttggtggtgtgaag
ctgaaggacaccctggaccgcatcaagattgacagcaacagcaaatatacccatctcgtc
atccgtgagacgaccatctctgacacaggagactacacactagaggtgaagaataccata
ggcatggcaactgaagttatcaaggttatcatcctggacaaaccgagtattcctgtgggt
ccagtaaagatcgaggaagttgacggtgtttcagtgacggttagttggcaacctccagag
aatgatggtggtgccaatgtcagcggatatgtcgttgagcaacgtgatgcccaccggcct
ggctggaccaccgtctccgagtcggtgacaaggccttgctttaaattcactaggctctct
gaaggaactgagtacgtgttccgtgttgcagccatgaatcgttttggcattggtggcttc
ctgcagtctgatgtggtagaatgcaagagcgccaagaccatccctggacccccaagcagg
ccagaagtgcttgatgtcacccatgagggcatgaccctgacctggaaaccacctgaggac
aatggtggctccactattgcgggctatatcatagaacgtaaagaggcccgttctgacagg
tggttgaggatcaacaaaaaccctgttactatgaccaggtaccgttcctccggactgatt
gagggcctggagtatgaacaccgtatcacagccattaactctagaggggctgggaaaccc
agcgagagttctgtcattaccatcgctttagaccccattgaacctccaggtcctccagtt
caggccagagtcacagacactaccaggacatctgtttctctagcttggcttccaccagaa
gaggagggtggttctgtcattactggctactttattgaaatgcagaaggtagaccagctg
gaatggacactgtgtaacacaactcccacgaagatgtgcgagtacatcatcacccacatg
ccacagggggctgaatacaaatttaggatcatcgcctgcaatgctggtggttgtggagaa
gctgctgagattcctggagtggttaaagtccaggagatgcttgattatcctgactatgag
ctggatcctaaatatgaagagggctatgtggtcagacaaggtggggtcatccacctgtct
gtacccattaagggtaaacccatccctacatgcaagtggaccaaggatggtcgtgacatc
tcccatcgggccatgattgctacccatgatgacatcactgagctggtcatcaaagaggcg
cataaagatgacactggtacctacgacttggtgctggaaaacaaatgtggcaggaaggct
gtttatatcaaggtgaaagtgattggtcgccctgatgccccagaagggcctctggaattt
gacgacattcaggcccgatcagtaagagtcagttggaggccaccatcagatgacggtggc
acagacatcctgggatacatagtggaaaggcgggaggtacccaaagctgcctggtataca
gtggatgctcgagtaattgggaactctctagtggtgaagggcctaaaggagaatgtggag
taccacttcagggttgctgctgagaatcagtttggtgtcagcagagctttaaaatctgac
gagtctgtcacaccaaagactccactttgcccacctgaacctcccagcaacccaccagag
atcatggatgttaccaagtccacagtttctctctcctgggccaggccccgcgacgatgga
ggctctcgtgtcactggatattatgttgaaagaagggaggtttcaacagagaagtgggtc
cgccacaacaagacccacatcaccaccaccatgttcaatgtcactggtctcatccctgat
gcagagtacatgttcagagttgtcgctcaaaatgacattggacagagtgaacctggtcct
gcttctgaatctgtagtctgcaaagatccatttgacaaacctagccaaccaggagagatt
gacattgtctctgtcactaaagactgtatcaccatccactggctcaggcctgagcatgat
ggtggcaaggagatcctaggttactggattgagttcaggcaggctggagagagtgcctgg
aaaaaatgcaacaaggagcgctcaaaggatcgtcagttcaccatgggtggcttaatggaa
gccactgagtatgagtttagagtctttgctgagaacgagactggactcagccgacctcgt
cgcacacctatgggcatcaagaccaaattgagtgttggtgaggctccagctttgacagaa
gacatccaagatgtaacaaccaaacttggcgagtctggcactctgacctgtggcattatt
ggcagacctctgcctgagattaagtggtaccgctttggcaaggaactgacccagagccgc
aagtacaaaatgagctcagatggtcggaaccactccctcagcattctaacagatgaacag
gaagatgagggcctgtacacctgcagggcaatcaatgaggctggagagatcgagagcagt
ggtaaactgcgtttacaggcagctccccagtttcaccctggctttcccctgaaggaaaaa
tactttgctggggctggcactagtctccgccttcatgtcgtatacattggccgtcctatc
ccacagatcatgtggttctatggcaagaagcctctgaatccatctgaaaatgtgatcatt
gaaaacacagagagctacacccacctcgtggtgaggaatgttcagagaaagaccaacgct
ggccgctataaggtgcagctcagcaatttctttggaactattgacactgtgcttcgtgta
gaaatccaagacaagccatgcatgcctgaggggcccctaattgttgaagccctgcttaag
agctcagttgtcatcagctggaaggctcccaaggatgatggaggatcaatgattaccaac
tacattgtggagaaacgggaggccaaagaaggggaacagtggtacctggtgtcctcctct
ttgtctggaaccacctgccgtgtcctcaatctgacagagaatgctggctactacttcagg
gtttcagctcagaatcaatatggagtcagcgagcctctagagatcccatcagtggttata
atcaagagtccatttgaaaaacctggcatcccacagcagcctttcattatcagctccaca
aaggactcttgtgttgtctgttggaagcctccaagcagcgatggtggagctaaaatcaca
agctactacctggagaaacgtgagaagaaacagaacaagtggatgtcagtaactaccaag
aagattgcagagaccaactatgaggtcacaggcttgattgaaggcttcgagtatgagttc
cgtgtcaaatgtgagaacatgggcggtgagagtgaatggagtgagatttctgaacccatc
atccccaagtctgaccaggctcctcgcgctcccacattcagggaggagatcagagacatg
actgtcaaataccatgccagtgccacatttgtcactaaggtgttgggctatccaaagcct
gttgtgaaatggtaccgtagtggaaaggaggtcctggcagatggaactaagatcaaagcg
ctggaattcaagggaggctactatcagcttgtcatcacttctgctgatgagaatgatgcc
acagtttaccaagtcagagcaactaattcctcaggatccatctctaccacagccaacttg
gaggtggaagttcctgctaagatccatctgcctcaagagctccaaggaatgggcgcagtc
catgctgtccgtggtgatcacgtcaccatcaagatccccatctctggcaaacctgagcca
acaatcacttggcagaaaggtcaggagatcctctccaactctccttatcaccaagtcatc
accacaaggtctttcacatccctggtattccagaaaggagtccagaggaaagatactggc
tactacattattactgcaaagaacagatttggaatggacaagcaaaccatcgaggtgaat
gtggctgacattcctgaagcaccaaaaggccttgtggttagtgaaattgcaagagattct
atcactcttgtctgggagccccctgtcagtgatggtggaagcaacattattagctacatt
gtagagaagtgccccaccaccagtgataggtggattcgtgctggacaaactactgactgt
agtatcactatcatcaacatatttggaaagaccaaataccagttccgtgttattgccgag
aaccagtttggtctgagcccaccatctgaaccaactgagcctatcaccacaaaggaagac
aagtctgtaattaggaactatgatgaggaagtggacgaaacaagagaaattactaaagag
gaggctcttttctacaaggtgaaggagctgtcctcaaagtacattatctctgaggagctt
gctcactgccagtttggtgtggttcaccgttgtattgagattgccacaaagaaaacctac
atggccaagtttatcaaagtcaaaggaactgatcgtgagttagttttaagggaaattgaa
gctcttaatgtgggaaggcacaagaatattgtctacctgcatgaatactttgaaagcatg
gaggagatcatccttatctttgaattcatttctggagttgacatctttgagcggcttggc
accagcaactttgagcttacagagcaggagattgtcaagtaccttagacaagtctgctct
gctctcaagttcctgcattcccacaactttggccactttgatatccgcccagacaacatt
gtgtacactacaaggaaaagtaccaacataaagatcattgagatgggccaggctaggctt
ctggtgccgggagaaaacatcagaatgctcttttcagcaccggagtactgcgccccagag
gtccaccgccatgatttggtcacaacggccacagatatgtggtccgttggtgttatggcc
tatgttctactcagtggccttaatccatttgcagcagagtctaccacaaagatgattgag
aatatcatcaactgtgagtatgtcttcgacagtgaagcatttaaggatatcagcctggag
gctatggactttgtggacagacttcttgtcaaggacaggaagcttcgtatgacagcccat
gaggctttggagcacccatggctcaagatgaaaatagagcatattagcaacaaggctatc
aggacactgagacacagaaggtactatcagactctggtaaagagggttgatactattgta
tcagcagctcgtgtggcctatggtggtgctttcaagaaccagaggggattggctgttggt
aaagtgaagattggaactgagtgccatggcttccgtgctggcccagtcatgcatgcctca
gctgaagaaggtggttatgcaagattcacttgtagcattgccaagtatgacaaaagtaca
caggtgtcatggtactttggtaactgccagctacacacaagccacaagtatgagattact
tatagtaatggctttgccagcatctacgtaaaggacattgaagaaagtgatgatggtgtg
tacagatgcaaagtggtgagtgatgatggagaagacagtgcttatggagagctttttgtc
gagacagtgaggagtatcaaagagtactatcttagccgctccatcaagaaattaaggagg
agagttgacaagactaagcttctgcagagaccaccagagttcactttgcctctctataac
cgcaccgctttcattggcgaagatgtgcgctttggtgttactgttactgtgcatccagag
ccttgcataatttggcttaagaatggtgaaaaaatcaagccaggtgataatgacagcaag
tacaccttcaccagtgataagggtctataccagctcatgatccataacctggacatgact
gatgatgctgaatacactgttatggcccacaacaagtttggagaagacagctgcaaggcc
cgtctcactgtggcaccacatcctgtgacagaagaaactatgaggcccatgttcaaacgt
ctgctagctaatgttgagtgcatggagggacagagtgtccactttgagctcagagtctca
ggtgtaccacctcctactcttaaatgggaaaaggatggtcatccactacagtttggtccc
aaggtggttgtcatacaggaggacgttgactctcatgtccttcacattagagagactcta
cttgaggactctggtgtttacaaagttactgcaaccaactctgctggcaccaccagctgt
caggcaacattgaaggtggaccgccttacctatacaaggagagaatataggagtgaggaa
gagaaatacatgcacatacagaaacaaattgaaaagaccaacaagatggctcagaaaatc
gttgctactgaggagcttgtacctcttaatcccactgctcaagaagctctcaaatatgct
gcagagatttacaagccagcagtgagcacgaagaatgttgagggtgagtttgacatcaca
gaggagaagtcagagaccaagaagttggaggaggagaggaggatcttcatgccctatgaa
attcctgagcctgtggttcatgatcccagagttcttgatgagaacaaaggtatcaaacag
tttgtacctctgtcagatatgaagtggtacagaaagctaaaagatcaatatgagatttca
gagaggatggagaggattgtgcagaagagacagaaacgtattcgtttgtccagatgggaa
cagttctacgtcatgccccttcctagaatcactgaccagtataggccaagatggcgtatt
ccaaaactcactctagatgatctggagaccgtcagacctgcacgccgctctcccagtcct
gtgtcagaggcgttgttcagatctaggaggagatctctgggagaccttagcgatgaggag
ctgaggataacagaggaagaagaaggaatgatgttggaggatgaactggagcttggcttt
tctgcctcacctgctggcagccctgtacacattgagcgacatgccatggagcatgaggaa
agaaggcatgaaggtagacatgagactgttgaggttgctgagacaaagaagaaacgtacc
atctctcagtatatgaggaggagaaggtcactgtcacccacttacattgagctaatgcgt
ccagtttcagaactgataagacaaccacatgctaggcatcctgtggaagtagagggagag
attgtggggaggaggtcccctaccccagagaggacccgaccacgttcccccagccccatc
aagtcagttgaaagatcttcacgctcctcttcgaggtttgagcggtctgcccgttttgat
atcatgtcccgttacgaggccagaaaggctgctctgaaatctgaaaggaagtatcaggtg
gtcagtcagacacctttcagtttagaccatgccccgcgtgtcactgttaggatgcgttct
catcgtatcccagttggtcaagatacaaaattcaccctaaatgtacaagctaaaccagag
gctgaggtcacgtggttccacaatggaactgcaatctctgaatccagtgagaaattcatc
tttaccaacatgactggtgtcttgtccatcactattctggactgtcaggaagaagatagt
ggcacgtatcgctgtgtatgttccaactctaagggagaggcttcagactatgctaccctg
gaggtgtcaggtggtagctacacaactttctcttctcgccgcaaggatgaggaagcgccc
aaaacatatgtccctgaagtcactcgaacagaccactaccacatctcccacttcaaagct
ggctatgcttcacagacccactttgaggtagaagaaaccaaatctaagttaactgaaaca
catgaggttttcacacatgagagatatggcgcctcctctgaaaggtactcctctgctgag
aggtatgactcatctatcaagtatgcttctgctgaatacctgtcatctagttcatcttat
tcatctgacaaattttctctgagtgggaaacacaccacatctgaagctaaactgaaatca
tctaccactgctggtgatgaggaagtttctatccagaaggcaaaactttctcttccagct
agaatcctcactaagcctcagtctgtgacagttgaggagggagagactgtcagatttacc
tgtgatattgatggtgagcctgcacccactgtgacatggatacatgagagcagaaccatt
gtctcatcccaccacattcaggtcaccacaactcagtataaatccagtttggaaatctcc
tctgtgacagcctcccatgagggcagttacacagtagtggtagagaattcagcaggcaga
caggaagctcattttactttaaccatccatagaccaacccccaagcaggaagttaaaata
gtcaaaccccctgagccatccgtgaagtcacccactcccagtgtaaagtcatctgcacct
tcagtcacgtcccctgttccctccacaacctctgctgttcccagtgtgaagtcaccagag
cctagcaccaaatccattgagacttcagttacatcaccagcttcaagtataaaatctccg
gaaccaagtgcaacatctcctgctccaagtgtgaagtcaccaacaccaagtgtgaagtct
cctgaacccgaggggattaagtctcctaagagcataaagtctcctgaaccaactgcacct
tctcctgcacagagcttaaaatcaccgactccaggtgtcaaatctcctgagcctgaggga
cctaagtcaccacgaggtctaaaatctcctgagctacgactcaagtcaccaccgccaact
aagaccctggggactggaaagtcactggaatctgaggaagtaaaatcaccccggggtatc
aaatctccagaacctacaggaatcaaaatgccaagaggtgtcaagtccccagaacctcct
ggactcaaaacaccaaaaggcatcaagtccccagaaccaacaggcatcaaatcaccaagg
gctctgaagtcccctgaacctgaagggatcaaatcaccacccagaatgaagtctcctcct
cccaccatgtcccccaagagagttgtatctccacccactgtaaaatccccaatcccaaaa
ccccccaaggtcacgagtcagctaacagcagaagcctgtgaggggtcagtgaggatgtcc
tgtgtttgtgagagctccgtcagagaggtggtttggtatgtcaatgggaggaggctttca
caaagcagtcaccttgagatgcactattctgagggttcttgcagccttgtgatccataat
ttaacagacaatgatcagggagagtacacctgtgagatgaaatcagaaggaggagtatcc
aagtcttctttcaacttcactggacaagtgtttcagtcaattcgcaagaagattacagct
tattgtgaacagcagctgggacttcaaggatcagtattgatgagtcaaaaggagtcatca
tcatccttgagttcatcagtgatgatgaagaaagaaatccatacaatggaggagtcgtct
gccttttcttctacttcccagcaggcagtgatgtcatccatgacagattcccgctccttc
agtagcatggcagctgaaatgaagtttgagaccatgtccatgtccagcatgtcctccgtg
tcatctgaggcatatgccatgagctccagtagcctcatggagatggcctcccacatggag
ggatcacttagagctcttggttctgctccaaggattgaagctctgccagaggacatcagc
attgagcctggcaaagtcctgacagtcgcctgtgccttctctggtgatgccagacacatt
gagtggtcgcacgacggcaaaacgattgagttgactgctgccggacgcttccatattgag
accactgaggacttgaccacgctcattatcactggggtgaaggaggaggatgctggaagc
tacaccctcaaactgtcaaatgagctgggatctgatacagcaactgttcacattagtatt
cgatcggtgtaa

DBGET integrated database retrieval system