KEGG   Oreochromis niloticus (Nile tilapia): 100702461Help
Entry
100702461         CDS       T06104                                 

Gene name
dhx8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:onl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100702461 (dhx8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:onl03041]
    100702461 (dhx8)
Enzymes [BR:onl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100702461 (dhx8)
Spliceosome [BR:onl03041]
 Complex C
  Other components
   Step II factors
    100702461 (dhx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 AAA_30 AAA_16 Flavi_DEAD PhoH ABC_tran Sigma54_activ_2 RSRP
Motif
Other DBs
NCBI-GeneID: 100702461
NCBI-ProteinID: XP_013128884
Ensembl: ENSONIG00000018248
UniProt: I3KPD5
AA seq 1213 aa AA seqDB search
MADIGVDELSQLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKQQSFDGFKALLLEN
GAEFTDSLISNLLRLIQTMRPPSKASTSKASESVAKPKSEKEKLRELFPALCRPNEPAPK
ALLDEDDVKVAADAMKELEMFMPSVSGTDSKGSKNRSEKNRRSRSRSREKDRHRDRDRDR
EKDRKRRHRSRSYSRSRSRSRDRDRHRDRDRDRGKRRDKSSRWSERSPSPRKDQERESDR
WRDKHVDRPPPEEPSVGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVAN
VADVVSKGQRVKVKVLSFTGSKTSLSMKDVDQETGEDLNPNRRRNVGPDGGEEISMRNPD
RPSNLNLGHAPELEQDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDDETGILP
KVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERR
ELKQAAREAEMDSIPMGLNKHWVDPLPDADGRQIAANMRGIGMMPNDIPEWKKHAFGGNK
ASYGKKTQLSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGY
TARGKIGCTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLL
RECLIDSELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQ
YFYEAPIFTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEID
TACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLT
IDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERA
YRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGAL
DDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQAL
ADQKKAKFHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMD
RHKLDVVSCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPE
WVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEE
PNAWRISRAFRRR
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
atggcagacatcggagtcgacgagctatcgcagctcgaatatctgtctttagtgtcgaaa
gtctgcacggagcttgacaaccatctgggaataaatgacaaagatttagctgaatttgtc
atcagccttgccgaaaaacaacagagctttgatggattcaaagcacttttactcgaaaat
ggagccgaattcacagattctctcatcagtaatctgctcaggctcattcagacgatgcga
cctccatccaaagcatctacaagtaaagcatccgagtccgtggctaagccgaagtcagaa
aaggaaaagctgagggagctgtttcctgcactgtgtagaccaaatgagccggcaccgaag
gctctgctggatgaagatgatgtaaaagtagcagctgatgccatgaaggaactggaaatg
ttcatgcccagtgtcagcgggacagactccaaagggagcaagaacagatcagaaaaaaac
aggcgaagtcgcagcagaagcagagaaaaagacagacacagagatcgagacagagatcgg
gaaaaggaccgaaagagacggcatcgttcccgatcctattccagatccaggtcacgctcc
agagaccgtgatcggcatagagatagagatagagaccgtggcaagagaagagacaaatct
tcccgctggtctgagcgctcacctagtccgagaaaagaccaagagagagagtctgaccgc
tggagggacaaacatgtggatcgccctccacctgaggagccttctgttggtgatatctac
aatggaaaggttaccagcatcatgcagtttggatgctttgttcaacttgagggactcagg
aagcgatgggagggtctggtccacatttctgagctgcgcagggagggccgtgtggccaac
gtggccgacgttgttagcaaaggccaaagagtcaaagtcaaggtgctctcattcacaggg
tccaagaccagcctcagtatgaaggatgtagaccaggagacgggagaagacctgaacccc
aacaggaggaggaacgtcggccccgacggaggagaggagatctccatgaggaatcctgat
cggccgagcaacctgaacctcggccacgcgccggagctggaacaggatgacacactggag
cgcaagaggctcaccaaaatctcagacccagagaagtgggagatcaaacagatgattgct
gccaatgttttgtccaaagaagaatttcctgattttgatgatgagacaggcatccttcct
aaagttgatgatgaagaggatgaagacttggaaattgagctggttgaagaggaaccaccg
tttctgagaggccacacaaagcaaagcatggacatgagcccagtcaagattgtcaagaat
ccagatggctcgctgtcccaggcagccatgatgcagagtgctctggcaaaagagagacga
gaactgaagcaggcggcgcgggaagcagagatggactccatccccatggggctgaacaaa
cactgggttgacccgctgccagacgctgatggtcgacagattgccgctaacatgagaggc
attggcatgatgcccaatgacatcccagagtggaagaaacatgcgtttggagggaacaag
gcatcctatggaaagaagactcaactctctatcttggagcagagagagagcttacccatc
tacaagctgaaagagcagctcgttcaggctgttcacgacaaccagatcctgatcgtcatt
ggagagacgggatctggaaagaccacacagatcacccagtacctggcagaggctggttac
acagccagggggaagattggctgtacgcagccccgtcgtgtggctgccatgtcagtggct
aagagagtttctgaggagtacggttgttgtctgggacaagaggtgggctacaccatccgt
tttgaggattgcacaagtcctgagactgtgatcaagtacatgacagacggtatgctgttg
agagagtgtttgattgactccgagttgggccagtacgccattatcatgttagatgaagct
catgagaggacaatccacactgatgttctttttggcctcctcaagaagactgtacaaaag
cgcacagacatgaagctgattgtgacatcagctacactggatgctgtgaagttctctcag
tatttctatgaagcacccatcttcaccatccccggcagaacgtatccagtagaggttctt
tacaccaaagaacctgagacggactacctggatgccagcctcatcactgtcatgcagatt
catctgactgagcctccaggagacatcctggtgtttttaactggacaggaggagatcgac
acagcctgtgagatcctttatgagagaatgaagtcacttgggcctgatgttcctgaactg
atcattctgccagtttattctgccctgcccagtgagatgcagaccagaatctttgaccca
gcacccccaggcagcagaaaggttgtcatcgccacaaacattgcagagacctctctgacc
atcgatggaatctattatgttgtagatccaggctttgtcaagcagaaagtgtacaactct
aagactggcattgatcagctggtggtgacgccaatctcacaggctcaggctaagcagagg
gcaggtcgtgccggcagaacaggccctggaaagtgttacaggctgtacactgagagagcc
tacagagatgagatgctgacaaccaatgtacccgaaatccagagaaccaacttggccagc
actgtgctgtcgctgaaggcaatgggcatcaatgatctgctgtcttttgacttcatggac
gctcctcctatggagactctgatcacagccatggagcagctctacaccttaggagctctg
gacgatgaaggcttactcacacgactgggtcgaaggatggctgaattccctctggagccc
atgttgtgtaagatgctgatcatgtccgtccatctgggctgcagcgaagagatgctcaca
atcgtgtcgatgctgtctgtgcagaatgtcttttacaggcctaaggacaagcaggccttg
gctgaccagaagaaggcaaagttccaccaacctgagggcgatcacctcaccctgctagct
gtctacaactcctggaagaacaacaagttctccaacccctggtgctacgagaacttcatc
caggctcgctccctgcgcagagcccaggatatccgcaaacagatgctggggatcatggac
agacataaactggatgtagtatcttgtggtaaagccactgtgcgagtccagaaagccatc
tgcagtggtttcttcaggaatgcagccaaaaaggatcctcaggagggctacagaaccctg
atagaccagcaagttgtttacatccacccctccagtgctctgttcaaccggcagcctgag
tgggttgtgtaccacgagctggtgctgactaccaaggagtacatgcgtgaggtgaccacc
atcgaccctcgctggctggtggagttcgcacctgccttctttaaagtgtccgaccccacc
cgcctcagcaagcagaagaaacaacagcgcctcgagcccctctacaaccgttacgaagag
cccaacgcttggagaatctcacgcgccttcagacgccgataa

DBGET integrated database retrieval system