KEGG   Oreochromis niloticus (Nile tilapia): 100704303Help
Entry
100704303         CDS       T06104                                 

Gene name
nat1
Definition
(RefSeq) arylamine N-acetyltransferase 1 isoform X1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00232  Caffeine metabolism
onl00983  Drug metabolism - other enzymes
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100704303 (nat1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100704303 (nat1)
Enzymes [BR:onl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     100704303 (nat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 GbpC
Motif
Other DBs
NCBI-GeneID: 100704303
NCBI-ProteinID: XP_003437596
Ensembl: ENSONIG00000020603
UniProt: I3KXR2
AA seq 290 aa AA seqDB search
MNLDEYFKRIGFHGSYDKLDLATLKLIHRQHVMSIPFEDLSIHCGEKITMDLEVIFNKMV
RSSRGGWCLENNSLFGWVLRQMGYDTTTLGSRVFSSTGGEYHTEETHLINKVIIDGNAYI
ADVSFGVSFQLWEPLELISGKEQSQAPGVFRLIDKGDMWVLEKTGRKPEVPNPEFAKSSL
LDKKQTQVMYSFTLEPREPYHFSQVNHDLQTDPTSLFINKSICSLQTPTGFRALVGWTYS
EVTFKPEEGVDVYDMRNVTDDELEEILREKFNVKLQKKLQAVNKKACYTL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggatgagtacttcaaaagaattggtttccatggttcctatgataaactggat
cttgcaacactgaagctgatccacaggcagcacgttatgtccattccatttgaggacctc
agcatccactgtggtgagaagattaccatggaccttgaggtcatctttaacaagatggtg
aggagcagccgcggaggctggtgccttgagaacaactccctgtttggctgggtgctgaga
caaatgggctatgacaccacaaccttgggctccagagtttttagcagcactggtggtgaa
tatcacactgaagaaacacacctcattaacaaggtcatcattgacgggaatgcttatata
gcagatgtaagttttggggtgtcattccaactctgggagcctctggagctcatctctgga
aaggagcagtctcaggcacctggtgtctttcgcctcatagacaaaggggacatgtgggtg
ctggagaaaactggcagaaaaccagaggttcctaatccagaatttgctaaatcaagtctg
ttagacaagaagcaaacacaggttatgtactccttcaccttggagcctcgtgagccatat
catttctctcaggtaaaccatgacctccagaccgaccctacctcactgttcatcaataag
tccatctgctctttgcagacacccacaggattcagagcactggttggctggacctacagt
gaagtcaccttcaaacctgaggaaggtgttgatgtgtatgacatgagaaacgtaacagat
gatgaactagaagaaattctgagggaaaagttcaatgtgaagctgcagaaaaaactgcag
gctgtaaacaaaaaagcatgctacacactttag

DBGET integrated database retrieval system