KEGG   Oreochromis niloticus (Nile tilapia): 100705333
Entry
100705333         CDS       T06104                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:onl03036]
    100705333 (ankrd53)
Chromosome and associated proteins [BR:onl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100705333 (ankrd53)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank_5 Ank 7TM_GPCR_Srd
Other DBs
NCBI-GeneID: 100705333
NCBI-ProteinID: XP_003447627
Ensembl: ENSONIG00000012939
AA seq 405 aa
MATMEPVNKPGKRRRGRCKKGKQSHHGALGRQMFPAVAAENPEKCAVNENQLSLNQQSLP
PLHVACLYGELGAVQLLVKSRQQWINSSDSQGRRPLHMVLSYQSFPRTCACLRYLLEHGA
DVNASTTDLGQTPLHLAASEGFLDCVEILVKAGADVLAKDSLGQTPLDLACIWCHRKIAR
YLKSCMWHVNKEKERKERVLVQALYTDLVGMAKQNNLTRKTLTDEKVAEWANKKGVALLK
DFSPRGQVSKYHTKCFLADQSNCDSKHAKAHCEEQQPEGIKEDRNTPPKPPFKPWSIFTG
LQPKKPLAEPDLRDSITIWRDSSSRQLQYTTRWDSTPRPAPNLPLDVLERVLFPRAFPSR
ITCPQDFEPQNIMEVKHQECPQEHSTSPWTEVAMCLVEVLEFRHY
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcaaccatggaacccgtcaacaagcccggaaaacggagacgtggaagatgtaaaaaa
gggaaacaatcccatcatggtgcgctgggcaggcagatgttcccagctgtggctgctgag
aacccggagaagtgtgctgtgaatgagaaccagctctccctgaaccaacagagtctgccg
ccgctccacgtggcgtgcctttatggcgagttgggtgctgttcagctcctggtgaagtcc
aggcaacagtggatcaacagcagtgattcccaaggtcgccggcccctccacatggtcctg
tcctaccagagcttccccagaacctgcgcctgtctcagatacctgctggagcacggcgcc
gacgttaacgccagcaccacagacttggggcagaccccgttgcacctggccgcctctgag
ggcttcctcgactgtgtagagatcctcgtgaaggccggagcagatgttttggccaaggac
agcttggggcagacacctctggacttagcctgcatctggtgccacaggaagatagcgagg
tatctgaagagctgtatgtggcatgtgaataaagagaaagaaagaaaggagagagtgctg
gttcaggccttatacactgatcttgtgggcatggccaaacagaataatctcaccagaaag
accctcactgatgaaaaggtggctgagtgggcaaacaagaaaggcgtggccctcctgaag
gatttctcccccagggggcaggtgagcaagtatcacaccaagtgcttcttagcagatcag
agcaactgtgactcaaagcatgcaaaggcccactgtgaggagcagcagccagaaggcatt
aaggaggacaggaacacccctcctaagccacccttcaaaccatggagcatcttcacaggc
ctgcagccaaagaaacccctcgcagaacctgacctccgtgacagcatcaccatttggagg
gacagctccagcaggcaacttcagtacaccaccaggtgggacagcacgcctcgccccgct
cctaacctgcctctggatgtacttgagagggtgttgtttcccagagccttcccctccagg
atcacctgcccacaggactttgagccacagaacatcatggaggtcaagcatcaagaatgc
cctcaggagcacagcacctccccctggacagaggtggccatgtgtctggttgaggtgctg
gagtttagacactactga

DBGET integrated database retrieval system