KEGG   Oreochromis niloticus (Nile tilapia): 100706037
Entry
100706037         CDS       T06104                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00100  Steroid biosynthesis
onl01100  Metabolic pathways
Module
onl_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100706037 (tm7sf2)
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100706037 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF4083
Other DBs
NCBI-GeneID: 100706037
NCBI-ProteinID: XP_003450518
Ensembl: ENSONIG00000001754
UniProt: A0A669BEX8
AA seq 425 aa
MRPNSQALKHKLSHDSEREFGGTLGAVCIPVFLPLTVLFLICLSRSPEASLFQWPPPLPS
TDQLWDPLAPVLLLGWFALHAVIYLMPLGKVSEGLVLRDGTRLKYPINGFHGLCISGVFL
MLLLGLGAPLGYLFELLLPLAVCAIAVSFLFSIYLYIRSFWAPSYELALGGNTGNPLYDF
FIGRELNPRIGDFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMILVNSFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQTLSSLKAAVI
IALNGIGYYIFRQSNSQKNQFRRDPTHPSVARLETIATATGKRLLVSGWWGLVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYVIYFTVLLIHREARDERQCRAKYGLAWDTYCRRVPYRI
FPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgagaccaaacagtcaagcactcaaacacaaactgtcacatgactcagagagggaattt
ggaggaaccctgggtgccgtgtgcattcccgtctttcttccattaacggtgctgttcctg
atctgtttgagccgatctcctgaggccagtttgttccaatggccacccccccttccctca
actgaccagctgtgggacccgctggcccccgtgcttcttctcgggtggtttgctttgcat
gcagtcatctatttgatgccattaggaaaggtgtctgaagggctggtgctcagagatgga
acacgcctcaagtatcccataaatggttttcatggcctgtgcatcagcggtgtgttcctg
atgttgttactggggcttggggctcctctggggtatctgtttgagctgctgttgcctttg
gcagtatgtgcaatagctgtgtcgttcctgttctccatctacctctacatccgctccttc
tgggctccttcctatgagcttgctttggggggaaacacaggaaacccgctctatgacttc
ttcatcgggcgggagctaaacccccggattggagattttgacctgaaatatttctgcgag
ctcagaccgggtctgattggctgggtggtcattaacctcggcatgctgatgaaggaggtg
gagctccgagggtccccctcccttgccatgattctggtcaacagtttccagctgctgtat
gtggcggacgctctgtggaatgaggaggctgttctgaccaccatggacattgtgcacgat
ggttttggtttcatgctggtcttcggtgatctggcctgggttcccttcacgtacggcctg
caggcagccttcctggttgtgcacccccagaccctaagttcactcaaggctgcagtcata
atagcactgaatggtattggatattacattttcagacaatccaactcacagaagaatcag
ttcaggcgggaccctactcatccaagtgtcgctagactggagaccattgccacagcaaca
gggaagcggctgctggtgtccggctggtggggtctcgttcgtcatcccaattaccttggt
gacctcctcatggccctcgcctggtcccttccgtgtggattctcgcatcttctgccttat
ttctacgtcatatacttcaccgttttactgattcaccgagaggcccgtgatgagagacag
tgtagagccaaatacgggctggcttgggacacatactgccgacgggtgccttacaggatt
ttcccttatatatactaa

DBGET integrated database retrieval system