KEGG   Oreochromis niloticus (Nile tilapia): 100709379Help
Entry
100709379         CDS       T06104                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00230  Purine metabolism
onl01100  Metabolic pathways
onl04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100709379
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100709379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:onl01001]
    100709379
Enzymes [BR:onl01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100709379
Protein kinases [BR:onl01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100709379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 100709379
NCBI-ProteinID: XP_019209022
Ensembl: ENSONIG00000011867
AA seq 1149 aa AA seqDB search
MRQQRRAFTSLPQTWKKTPESSPDFCLSYSAFIIKSSPSAHPPSSLNPCCCAPNLPPSLT
PLSLCGLLRFLFILLASLCLLPCPTQAAWFRVGVVGPWGCDPLFAKALPSVAAQLAVNRI
NKDASLSYAVTFEYAVLQEPCETSRALEAFVGFHTKASGYIGPANPGYCDAASMLSKGWN
KALFPWGCVGYELDDVRSHPTFARSMARPTWVLLSVMSYFRWAHIGIISSSEDIWMETAT
KVADALRSHGMPVRLVTFMENTPHGIRRALTKVRKMSEIRVVILCMHSVLIGGTAQRLLL
ETAYDMQMIDGSLVFLPYDTLLYSLPYHNVTYPALKRNNKLLRAYDAVLTITIDSPRVSF
YEAYREAMERGEVASTLKPQQVSPLFGTIYNSVIFMAHAVHRVRESREWMSGGNLAQQSR
NLAFQGFSHPIKTNGSGAALLEYLILDTDGISWELKPTHRIDMEIGMVRFLGKDIHFPRG
YGPKKDASCWFTPGVICSGGVDLFSTISVLLGVIAAFIVAVPLIYCIRRRINQIRLVRGP
NKILLTLADVTFINPSLSNKKLSLDDSRTSGMKSMSERSLASTISTQSPATYENSNVVIF
EARPSIYEGDWAWLKRLPYGTFSSINPKTSDVFELMKDMRHENVNPFLGFFHDCGVFAIV
TEFCSRGSLEDLLLNEDVKLDWMFKSSLLLDLIKGMKYLHHRGVSHTRLKSRNCVVDGRF
VLKVTDYGYNEVLEAQRFPYVEPHADELLWTAPEILRSGQAGLHGTLPGDVYSFAIIMQE
VVVRGPPFCMLDLSDKEIIEKLCKPPPLCRPVVSPDYAPMECIQLMKQCWNEQPDKRPAF
DEIFDQFKNINKGKKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLP
PSVAEALKVGGTVEPEYFDQVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGN
HDVYKVETIGDAYMVASGVPVPNGIRHATEIANMALDILSAVGTFKMRHMPDVPVRIRIG
LHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESSGMPYRIHVHQSTVKVLHELNLGYKLE
LRGRTEVRGKGIEETYWLVGRDGFTKPLPVPPELKSGQMAHGLQMAEIAQYKKRKAEKQQ
QEQLAKKKN
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagcaacgccgtgccttcacctccttacctcagacatggaagaagacaccagaa
tcatctcctgatttctgcctttcctactcggcttttataattaagtcatctccctcggct
catcctccttcctccttaaatccatgctgctgcgctccaaatcttcctccttccctcaca
cccctttccctttgtggcctgttgaggttcctcttcatcctcctggcctccctgtgctta
ctgccctgtccaacccaggcagcttggtttcgggttggagtggtggggccctggggatgt
gaccctctctttgccaaggcccttcccagtgtggcagcacagctcgccgtcaatcgcatc
aacaaggatgcctctctgtcctatgctgtaacatttgagtatgcagtgctgcaggagcca
tgtgagacatccagggcactggaggcatttgtgggtttccacaccaaagcttcaggctac
attggcccagccaacccaggctattgtgatgctgcttcaatgctgagcaaaggctggaat
aaagcactgtttccttggggatgtgttggctatgagttggatgatgttcggagccatccg
acttttgctcgctcgatggcaagacctacctgggtcctacttagtgtcatgagctacttc
aggtgggctcacattggcatcatctcttcctctgaggacatctggatggaaacagcaacc
aaggtggctgacgccttgaggagccatggcatgccagtcagactggtcacttttatggag
aacacacctcacggcatcagacgagctctcaccaaggtccgcaagatgagtgaaatacga
gttgtgatcctctgcatgcactcagttctgattggtggcacagcccagaggcttctactg
gagacggcctacgatatgcagatgatcgatggctctctagtgtttcttccttatgacaca
ctgctctacagtctgccctaccataatgtgacctacccagctctgaagagaaacaacaaa
ctgctgcgggcctatgatgccgtgctgaccatcaccatcgactcaccccgggtgtcgttc
tacgaggcttatagagaggccatggaaagaggagaggtggcgagtacgttgaaaccccag
caggtatcgcctctgtttggtaccatttacaactctgtcatcttcatggctcatgcagtg
catcgggttcgggagtccagggagtggatgtctggaggaaatttggcacaacagagccga
aacttggccttccagggcttcagccacccaattaaaactaatgggtctggagcagctctg
ctggaatacctcatactggacacagatggaatatcttgggagctgaagccaacacacagg
atcgacatggagatcggtatggtccgcttcttgggtaaagacatccatttccctcgaggt
tatggacccaagaaagacgcctcgtgctggtttactccaggagtcatctgctcaggagga
gtggatttgttctcaaccataagcgtgctccttggggtgattgctgcctttattgttgct
gtgccactaatttactgcatcaggcgacggataaatcagatccggctggtcagaggtccc
aacaagattttacttacactggccgatgtcacattcataaacccatcacttagcaacaag
aagctgagtcttgatgacagtaggactagcggcatgaagagcatgtctgaacgcagtctt
gcctcaacgatttccacccaatcgccagccacctacgaaaactccaacgttgtaattttt
gaggcaaggccatccatttatgagggggactgggcgtggctgaagaggcttccttatggg
acgtttagcagcatcaatcccaaaacgagtgatgtgtttgaactgatgaaggacatgcgt
catgagaacgtcaacccttttcttggcttttttcatgactgtggcgtattcgccattgtg
actgagttctgctccagaggcagcctcgaggacctgctcctaaatgaagatgtcaagctc
gactggatgttcaagtcatctctgttgctggatctaattaagggtatgaagtatctccat
caccgtggagtgtctcacactcgtctaaagtctcgcaactgtgtggtggatggacgtttt
gtcctgaaggttacagattatggctacaatgaagtcctagaggctcagaggttcccctat
gttgagccacatgcagatgagttactttggactgctccagagatcctgaggagtggccag
gcaggactacacgggactttacccggtgatgtgtacagcttcgccatcatcatgcaggag
gtggtggtgagagggcctccattctgcatgttggacctgtctgataaagaaataatagag
aagctgtgtaagcctcctcctctgtgccgtccagtggtcagtccggactatgctccaatg
gagtgtatccagctgatgaaacagtgctggaacgaacagccagacaagcggccggccttt
gacgaaatctttgaccagttcaaaaacatcaacaaggggaagaaaaccaacatcattgac
tctatgctgaggatgctggagcagtactcgtctaacctggaggagctaatcagagagcgg
acagaggagctggagatagaaaaacagaagacagagaagcttttgacacagatgctgcct
ccgtctgtggcagaggctttgaaggtgggcgggacagttgaaccagaatattttgaccag
gtgtcactgtatttcagtgacatcgttggcttcaccaccatctcagctaatagcgaaccc
attgaagtggtcgatctcctcaacgacctctacacgctctttgacgccatcataggaaac
catgatgtctacaaggtggagacaataggcgatgcttacatggtagcgtcaggtgttcca
gttcctaatggcatccgacatgctacagaaatagccaacatggctcttgacattctgagt
gctgtggggacctttaaaatgagacacatgcccgatgttccagtgaggatacgaatagga
cttcacacaggtccgtgcgtagcaggtgttgtgggtctcaccatgcctcgctactgtctg
tttggagacacagtgaccactgcctctcgtatggagtccagcgggatgccttacaggatc
catgttcatcagagtactgtgaaggtcctccatgaactaaatcttggctacaagttggag
ttgagaggaaggacagaagtccgggggaaaggaatagaggagacctactggctcgtaggg
agagatggatttaccaaacccctgcctgttcctccagaactcaagtctgggcaaatggcc
catgggctgcagatggccgagatagcccagtacaagaaacggaaagccgagaaacaacaa
caggaacaacttgcaaagaagaaaaactga

DBGET integrated database retrieval system