KEGG   Oreochromis niloticus (Nile tilapia): 100710174
Entry
100710174         CDS       T06104                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:onl01002]
    100710174
Enzymes [BR:onl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100710174
Peptidases and inhibitors [BR:onl01002]
 Metallo peptidases
  Family M1
   100710174
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_M9_N
Other DBs
NCBI-GeneID: 100710174
NCBI-ProteinID: XP_013133073
Ensembl: ENSONIG00000016958
UniProt: I3KJU1
AA seq 959 aa
MISAEAACRGRSGPASVVTMLVAPLLLVLFVPFSPSSGAQLPNQAKAKDLPIATNGQPFP
WDRMRLPTTVTPLHYDLAIHPNLTTLDFTGVVRIELDVHEDTNTVILHAKQMQISNVFLL
APEGIKRLQVLEYPRFHQLALLSDSMLIKGRKYEVHLAFAANLSDSFHGFYKGSYRTSSG
EVRVLASTQFEATFARGAFPCFDEPAFKANFTIRIIREPRHIAISNMPMVKTVELPGGLL
EDHFDTTVKMSTYLVAYIVSDFKSVSKTTQHGVKISIYAVPEKIDQTAFALDAAVKLLDF
YDDYFDIPYPLPKQDLAAIPDFQSGAMENWGLTTYRETGLLFDPEKSSASDKLGITKVIA
HELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFISLDITYPELHVDDFFLAKCFEAMEVDS
LSSSHPVSTPVENPTQIQEMFDDVSYDKGACILNMLRDFLTPEAFEIGIVRYLKRYSYQN
TVNSHLWESLTNICSSDDLDEGRLKHTEFCSKRKTQTGASKWYSGDELDVRAIMDTWTLQ
EGFPLVTVEVRGREVRLSQERYLKTDDPSPSEGFLWQIPLTYKTSASNTVHRFLLKTKTD
VLFLPEEVDWVKFNVDMSGYYMVHYAGEGWNSVIKLLQHNHTALSGNDRANLIHNVFQLV
SIEKVRLDTALELSLYLSRETKIMAVTQGFGELVPLYKLMEKRDMKVLENQMKSYIVDLF
QDLIDQQEWNDSGSVSQRVLRSYLLLFACVRNYAPCVTKATQLFNQWKDSDGTMSLPVDI
TMAVFVIGARMPEGWDFLFEKYRHSLQMSVKSRMKTAMAVSPLQDKLKWMMEQSLIGEIM
KTQDLPDVVVSVSKNPHGYQLAWDFLRANWHTMIKKFDLGSHTISHLVTGVTNQYSTREM
LDEVRNFFGSLTEETGSEMRCIQQAYETIEDNIRWTDKNLPLLQAWLDKRNRRVFHEDL
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgatttctgctgaagctgcgtgcaggggacgaagcggtcctgcctctgttgtcaccatg
ttagtggctcctctcctgctggtgctgttcgttcccttttctccctcatctggagcacag
ttaccaaatcaagccaaggccaaagacctccctattgccaccaatggtcagcccttcccc
tgggaccgcatgagactccccacaaccgtcactccactccactatgacctggccatacac
cccaatctgaccaccctggacttcactggcgttgttcgtattgagcttgatgtgcatgaa
gacaccaacactgtgattctccatgccaagcaaatgcagatatccaatgtgttcctcctg
gcacctgaaggcattaagcgccttcaggtgttggagtatcctcgcttccatcagctagcc
ttgttgtcagattcaatgctcatcaaaggtaggaagtatgaagttcatctggcatttgct
gccaacctgtctgacagtttccatggtttctacaagggaagctaccgcaccagcagcggg
gaggtcagagtcctggcatccacgcagtttgaagcgacttttgctcgtggagccttcccc
tgttttgatgaacccgccttcaaagcaaacttcaccatacgaattattcgagagccacgc
cacatagccatatccaacatgccaatggttaaaactgtggagttgccgggcggtttgctt
gaggatcacttcgacaccactgtgaaaatgagcacctacctggttgcctacattgtgtcg
gacttcaagtctgtgagcaagacgacccagcatggtgtcaagatttcaatctatgctgtc
cctgagaagatcgaccagacagcctttgcactggatgctgctgtcaagctgctggacttc
tacgatgactattttgacattccttacccacttcccaaacaggacctggcagctattcct
gacttccagtcaggtgcgatggagaactggggactgaccacctacagagagaccggcctc
ctctttgaccctgaaaagtcatcagcttcggacaaattgggcatcaccaaggtcatcgcc
catgaacttgcgcaccagtggtttggaaacctggtgacgatggagtggtggaatgacttg
tggctcaatgaaggttttgccaagttcatggagtttatttctctcgacatcacgtaccca
gaacttcatgtggatgatttcttcttggcaaaatgttttgaggctatggaagtagactcc
ctcagctcctcccacccagtctccacccctgtggaaaaccccacacagatccaggagatg
ttcgacgatgtgtcatatgacaagggtgcatgcattctgaatatgttgcgggacttcctc
actcctgaggcttttgagattggcatcgtccgatacctgaagcgctacagctaccaaaac
actgtgaacagccacctgtgggagagcctgaccaatatctgcagctcagatgatctggat
gaaggtcgactgaaacacacagaattctgctctaaacgcaaaactcagaccggagcctcg
aagtggtactctggtgatgagctagatgtcagggccatcatggacacctggactctgcag
gaaggcttcccactggtcacggtggaggtcagaggtcgggaagtcaggctcagtcaggag
cgttacttgaagacagacgacccctccccgagtgaaggattcctgtggcagatcccgctg
acgtacaagaccagtgcctccaacactgtccaccgctttctgcttaagacaaagactgat
gtcctgttcctgccagaagaggtagactgggtgaagttcaatgtggacatgagtggttac
tacatggttcattatgcaggcgaggggtggaactctgttatcaagctgttgcaacacaat
cacacagccctgagcggtaatgaccgtgccaacctcatccacaatgtcttccagcttgtc
agtatagagaaggtgaggctcgacacggctttggagctgtcgctttacctgtccagagag
accaagatcatggctgtgactcagggctttggagagcttgtaccgctttacaaactgatg
gaaaagagagacatgaaggtgctggagaaccagatgaagagctatattgtagatttgttc
caggatttgattgaccagcaggaatggaatgactccggctccgtgtctcagcgagtgttg
aggagttacctgctgctgtttgcctgtgtcaggaactatgctccctgtgtgaccaaagcc
acccagctctttaaccagtggaaggactctgatggcaccatgagccttcctgttgatatc
acaatggctgtgtttgtgattggagctcgaatgccagagggctgggatttcctctttgag
aagtaccgccattcgctgcaaatgtcggtcaagagccgcatgaagactgccatggctgtt
agcccactgcaggacaagctcaagtggatgatggagcagagcctcatcggtgagataatg
aagactcaggacctcccagacgtggtcgtctctgtcagcaagaacccccatggctaccag
ctggcctgggacttcctcagagccaactggcacactatgatcaagaagtttgaccttggc
tcccacactatatcacacttggtgactggggtaactaaccagtactctaccagagagatg
ctagatgaggtacgaaacttcttcggctccctgacagaggagacgggctcagagatgagg
tgcatccagcaggcctacgagaccattgaggataacattcgctggacggacaaaaatctt
cctcttctgcaggcttggctggacaagcgcaaccgtcgagtgtttcacgaggatttatag

DBGET integrated database retrieval system