KEGG   Oreochromis niloticus (Nile tilapia): 100710536
Entry
100710536         CDS       T06104                                 

Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00230  Purine metabolism
onl00240  Pyrimidine metabolism
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100710536
   00240 Pyrimidine metabolism
    100710536
Enzymes [BR:onl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100710536
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 100710536
NCBI-ProteinID: XP_019219148
Ensembl: ENSONIG00000017798
AA seq 303 aa
MRAEFNLSSISRAGQWVSKQRRAIIDSQRSIREHGDPPKRPCIPPCSPPLDGSFSRQRKE
KKISIEGNIAAGKSTFVRLLQAASEDWEVIPEPIGKWCNVQNDSDDVYLELSSSQKSGGN
LLQMLYDKPSRWSYTFQSYACLSRVRAQLQPPSIKLQQAENPVQFYERSVYSDRYVFASN
LFESGDLSETEWSVYQDWHTWLLNQFESDIALDAIIYLRAPPQRCMQRLLHRGRQEEQGI
PLEYLEQLHFKHEAWLYDRNLRLDFDYLSELPVLVLDVNDDFKKDRIKQEAIIDKVREFL
TTL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgcgcgcggagtttaatttgagcagcatctcgcgcgccggtcagtgggtttccaaacaa
cggcgagcaatcatcgatagtcagcgatcgatccgtgaacatggcgaccccccgaagagg
ccatgcatccctccctgcagcccgccgctggacggcagcttttcccgccaaaggaaggag
aagaagatctccatcgaaggaaacatagctgcaggaaagtcgacgtttgtgcgcctcctt
caggcagcatcagaggactgggaggtcatccctgaacccattggcaagtggtgcaacgtc
cagaatgacagcgatgacgtttacctggagctgagctcatctcaaaagagtggaggaaac
ctgctgcagatgctgtatgataaacccagccgctggtcctacaccttccagagctacgcg
tgtctgagcagagttcgagctcagcttcagcctccatcaatcaaacttcagcaggcagaa
aaccccgtccagttctacgagcgctccgtctactccgacaggtacgtgtttgcgtccaac
ctgtttgagagtggcgacctgtcggagacggagtggagtgtgtatcaggactggcacacc
tggttactgaaccagtttgagtccgacatcgctctcgacgccatcatctacctcagagcc
ccgccacagcgctgcatgcagcggctgctccatcgcggccggcaggaggagcagggaatt
cctctggagtacctcgagcagctgcacttcaaacatgaggcctggctctacgacaggaac
ctcagattggactttgattatttgagcgaacttcctgttctcgtcctggacgtcaacgac
gacttcaagaaggaccgcatcaaacaggaagccatcatcgacaaggtcagagagtttctc
accacactgtga

DBGET integrated database retrieval system