KEGG   Oreochromis niloticus (Nile tilapia): 100710882
Entry
100710882         CDS       T06104                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100710882 (rdh5)
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100710882 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 100710882
NCBI-ProteinID: XP_003456138
Ensembl: ENSONIG00000006842
UniProt: I3JIE0
AA seq 332 aa
MDTQFVYDLLGENAWLYISATFIVLWIVGWLYRDSLEIEDFKSKYVFVTGCDTGFGNLLC
KKLDRKGFRVLAGCLTEKGADDLKRVAGPYLKTVLLDVTSQDSIEKAMEWTKQEVGDKGL
WGLVNNAGRSLPMGPSEWMKVEDFHSTLKVNMNGVIAMTMTFLPLIKQARGRIVNVASVL
GRVAANGGGYCISKFAVESFSDCLRRDIHYFGIKVCIVEPGFFKTAVTSLEPIERELHRL
WNQLSPEVKASYGDKYLDKYIKTQRLIMNAVCDSDLTKVTNCMEHALSAAYPRTRYSAGW
DAKLVWIPLSYMPSFVVDIALKLVLPRPSKSV
NT seq 999 nt   +upstreamnt  +downstreamnt
atggatacacagtttgtgtatgaccttttaggggaaaatgcttggttatacatctctgct
accttcattgtgttgtggattgtcgggtggctctacagagacagcctggagattgaggat
ttcaaatctaagtatgtctttgttactggctgtgacacggggtttggaaacctgctgtgt
aagaaactggatcgtaaaggtttccgtgtactagctggctgtctcacagaaaagggagct
gatgatctgaaaagagtggcagggccttatctgaagactgtcctgctggatgtgaccagt
caggatagcattgaaaaagcaatggagtggaccaagcaagaggttggcgataagggactt
tggggtcttgtgaacaatgctggacgttcattacccatgggtccatcagagtggatgaaa
gtggaggatttccacagcacactgaaagtaaacatgaatggagtgattgccatgacaatg
accttcctgcccctcatcaaacaggctcgtggccgtattgtaaatgtagcatcagtgctt
ggtagggtggcagcaaatggtggtggatactgcatttccaagtttgcagtagaatctttc
tctgactgcctcaggagagacatccactactttggaattaaggtgtgtatcgttgagccc
gggtttttcaagactgcagtaacaagccttgaacccattgagagggagctccatcgcctg
tggaaccaactcagccctgaagtaaaggccagctatggagacaaataccttgataaatat
atcaagacacagcgtttgatcatgaatgccgtctgcgactctgacctcactaaagtgacc
aactgcatggagcacgctctctctgctgcctaccctcgcaccagatacagtgctggctgg
gatgccaagcttgtctggatccccctctcttacatgccttcctttgtagttgatattgca
ctgaagctcgtgcttccacgtccttcaaagagcgtctga

DBGET integrated database retrieval system