KEGG   Oreochromis niloticus (Nile tilapia): 100710897Help
Entry
100710897         CDS       T06104                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl03013  RNA transport
Brite
KEGG Orthology (KO) [BR:onl00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100710897
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:onl03012]
    100710897
Translation factors [BR:onl03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100710897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI DUF2779
Motif
Other DBs
NCBI-GeneID: 100710897
NCBI-ProteinID: XP_019218173
AA seq 925 aa AA seqDB search
MSRFFATGSDSESEESSSADEITPKAPGATFKQSLLLSDDEEDTKRVVRSAKDKRFEELT
NLIKTIRNAMKIRDMSKCLEEFEQLCRAFLKSKNIVDKEGIPPFYIRLLADLEDYLNQLW
EDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESEIAAYKENPQESADEEEEEKEPEDSGS
SSDSEGEVSSKSFLKKKPEAPSEATKFLKTAKGSGDESSSSDEDDDDDDEDWGSDQSGSS
GETSDKEEGKTSSMSVLFLKKAQDTEKLGVRKEERKKKLKQKERIEEEAEEEGGEESGGG
WEKVKGGVPLVKEKPKMFAKGTEINTAVVVKKLNEILQARGKKGTDRAAQIELFHALAAI
AAENNLGQGILVKIKFNIIASLYDYNPNLAAFMKPDMWKKCLDCIDELLDILFEHNNIFI
GENIAEDSENLAVSDQPFRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVDNLKDEGRVC
GIVDRLLTYLENKGSTEEICRVYLRRIMHTYYKFDYKAHRRSLGLQGETKSEQDQEESEG
EDSAVIMDRLCKFIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHA
DPPVQILYNRTMVQLGICAFRQGMIKDAHNALLDIQSSGRAKELLGQGLLMRNMQERNAE
QEKIEKRRQVPFHMHINLELLECVYLVSAMLLEIPYMAAHEFDARRRMISKQFHHQLRVG
ERQPLLGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPEAQRVREMLVR
KIQEESLRTYLFTYSSVYDSISMATLSEMFELEMPTVHSIISKMIINEELMASLDQPTQT
VVMHRTEPTSLQNMALQLAEKLGNLVENNERVFDLKQGVYGGYFNRDQKGGYQQKQSYQR
DQKSYQQKQSGYQRGGYRNQNQGNY
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgattctttgccactgggtctgacagtgagtcagaggagtcctcatctgccgat
gagatcacccctaaggcacccggagccactttcaagcagtcgctgcttcttagtgacgat
gaggaggacacaaaaagagtggtgcgcagcgccaaagataaaaggtttgaagagttgacg
aacctcataaagactatccgcaacgctatgaagattcgagacatgtccaaatgtctggag
gagtttgagcagctttgtcgagccttccttaaaagcaagaatatagtggataaagagggt
attcctcccttctatatccgccttctggctgacttggaggactatttgaaccagctttgg
gaggataaagaggggaagaagaagatgaacaaaaacaatgcaaaagctctcagcaccctg
cgtcagaagatccgcaagtacaacagagactttgagtcagaaatagcagcatacaaggag
aatccacaggagtctgcagatgaggaggaggaggagaaggagccagaagactctggctcg
tcctctgacagtgaaggagaggtgtcatccaagtccttcttgaagaaaaagcctgaggcg
ccttcagaagccaccaagtttcttaagactgccaagggatctggggatgagtcctcttct
tctgatgaagatgatgacgatgatgatgaagactggggctcagaccagtcaggcagcagc
ggtgaaacctctgataaggaagaaggaaagacctcatccatgtctgtgctcttcctcaag
aaagcccaggacactgaaaagctcggtgtcaggaaggaggagaggaagaagaagctcaaa
cagaaagaacgcattgaggaggaggctgaggaggaagggggcgaggagtccgggggaggc
tgggagaaggttaagggaggagtacctctggttaaggagaaacccaaaatgtttgctaaa
ggcacagagatcaacactgcggtggtggtgaagaagctgaatgagatcctgcaagcaaga
ggcaaaaaaggaacagacagggcggctcaaattgagctatttcatgctctggcagccatc
gctgcagagaataacttgggccaaggtatcctggtcaagatcaagttcaacattattgcc
tccttgtacgactacaaccccaacctggcagccttcatgaaacctgacatgtggaagaag
tgtctggattgtatagatgagctgctggacattctctttgagcacaacaacatcttcatc
ggagagaacatcgcagaggacagcgagaatctggccgtctccgatcagcctttcagggtg
cgcggatgcatcttaaccctggtagaaaggatggatgaagaatttacaaagatcatgcag
aacactgatccccactctcaggaatacgttgacaatctgaaagacgagggcagggtttgt
ggcatcgttgaccggctgctcacctacctggagaacaaaggctccacagaagaaatttgc
cgtgtctacctgcgcagaatcatgcacacctactacaagtttgactacaaagctcacaga
cgcagcctgggcctgcagggagagaccaagtccgagcaggaccaggaggagagcgagggg
gaggacagcgctgtgatcatggaccgcctctgcaagttcatctacgccaaggatcggacc
gaccgtatccgtacctgtgctatcctctgccacatatatcaccatgctctgcactcacgc
tggtaccaggcacgtgacctgatgctgatgagtcacctgcaggacaacatccaacacgct
gacccacctgtacagatcctgtacaacagaacaatggtccaacttggcatttgtgcattt
aggcagggcatgattaaagatgcccacaatgcactgctggacattcagtcctctggccgt
gccaaggagctgctgggtcaaggtttgctcatgaggaacatgcaggagaggaatgcagag
caggagaagattgaaaagcgaagacaagtgccattccacatgcacatcaacctggagctg
ctggagtgtgtgtacctggtgtcagccatgctgctggaaataccctacatggccgcccat
gagtttgatgcccgccgccggatgatcagcaagcagttccatcaccagctcagggtcggg
gagagacagcccctgctaggacccccagagagcatgagggagcacgtggtggcagccagc
aaagccatgaagatgggagactggcgtacctgccactctttcatcatcaatgagaagatg
aacagtaaggtttgggacctgttccccgaggcgcagagagtacgcgagatgctcgtcagg
aaaatccaagaagagtcactgaggacctatctgttcacctacagcagtgtgtacgactcc
atcagcatggcaacgctgtctgagatgtttgaattggagatgcccacagtccacagcata
atcagcaagatgatcatcaacgaggagctgatggcatcactcgaccagcccacacagacg
gtggtgatgcaccgcaccgagccaacgtctctgcagaacatggctctgcagctggcagag
aaactgggcaacttggttgagaacaacgagcgcgtatttgacctcaaacagggcgtctat
ggaggttacttcaacagggatcagaaaggtggctaccaacagaagcaatcctaccagaga
gatcagaaatcttaccagcagaagcagtcgggttaccagagaggcggttacaggaatcaa
aatcaaggaaattattga

DBGET integrated database retrieval system