KEGG   Oreochromis niloticus (Nile tilapia): 106098248
Entry
106098248         CDS       T06104                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
onl04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106098248 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106098248 (apln)
SSDB
Motif
Pfam: Apelin TMEM65
Other DBs
NCBI-GeneID: 106098248
NCBI-ProteinID: XP_013126785
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTVHGRELQDASMVRKMVQQNSARGGQTHRPTSS
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacggtgcatggcagagagctgcaagatgcatctatggtg
agaaaaatggtccagcaaaactctgcaaggggcggtcagacccacagaccaaccagctca
aagagaagacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system