KEGG   Oreochromis niloticus (Nile tilapia): 109195683Help
Entry
109195683         CDS       T06104                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00120  Primary bile acid biosynthesis
onl01100  Metabolic pathways
onl03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    109195683
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    109195683
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:onl00199]
    109195683
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     109195683
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     109195683
Cytochrome P450 [BR:onl00199]
 Cytochrome P450, animal type
  CYP8 family
   109195683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 109195683
NCBI-ProteinID: XP_019203771
AA seq 521 aa AA seqDB search
MNLCWLTESVMELLLPILLGFLACLVGGLYLLGVFRQRRPGEPPLDKGLIPWLGHVLEFR
RNTLKFLERMEKKHGDIFTVQLGGFYITFLQDPFSFGGFVKESRDKLDFRKVALHLVHRV
FGYKAVEGERRIHEMSNNKHLKGEGLQELTQSFMSNLQNMMLHNIGSAAEDRTWKEDGLF
RYSYNVVFRAGYLALFGNVPPKSEQSEEKAKEKDRAESEALFHEFRKYDQLFPRLAYGVL
PPMEKLAAERLKTYFWDVLSILKMKTKDNISGWVWDIQQGKEEMGMDVSMINRNMFMLLS
ASQGNTGPSSFWLLLFLMKHPEAMKAVKEEVDKVLKESGQEVWPGGPMVNLTREMLLKTP
ILDSAVEENLRLTAAPLLTRAVIKEMTFKMADGREYLLRKGDRIAIFPFSSVQHDPEIHP
EPHSFKYDRFLNPDGTKKTDFYKAGKKVKYYTMPWGSGVSMCPGRFFATNELKQFVFLML
VYFELELKNPDEKIPEIDLSRYGFGTMQPVRDVQFRYRLRY
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtgctggttaactgaatcagtcatggagctgctgctgccgatccttcttggc
ttccttgcttgtctggtcggagggctgtaccttctcggagtgttcagacagcggcgacca
ggagaacccccccttgataaagggctcattccttggttgggtcatgtcttagagtttcgc
aggaacaccttgaagttcctagagagaatggagaagaagcacggtgatatatttacagta
cagctgggagggttttatattacatttctccaggaccctttttcatttgggggattcgtt
aaggagagtcgggacaaactggactttcgaaaggttgctctgcatctggtgcacagagtg
tttggatataaagctgttgaaggggagcgtaggattcatgaaatgtccaacaacaagcat
ctgaagggggaaggtctgcaagaactgacccagtcttttatgagtaatttacaaaacatg
atgttgcacaacattggatcagctgcagaggacaggacctggaaagaagatggactgttc
aggtacagctacaatgttgttttcagagctggatatttggccttgtttggcaatgtgcca
cccaagtctgaacaaagtgaggagaaagccaaagagaaagacagagctgaatcagaagct
ttgtttcatgagtttcgtaaatatgaccagctcttccccagactggcgtatggggtcctc
ccaccgatggaaaagttggctgcagagaggttgaagacatacttctgggatgttctgtca
atcctgaaaatgaaaaccaaggacaatatcagtggctgggtgtgggacatacagcagggt
aaagaggagatgggaatggatgtgtcaatgataaacaggaacatgtttatgcttctttcg
gcctctcagggcaacacagggccttcttcattctggctgctcctcttcctcatgaaacac
ccagaagccatgaaagcagtgaaggaagaggtggataaagttctgaaagaatctggacag
gaggtctggcctggtggtcctatggtcaacctgacccgtgaaatgctgttgaaaacaccg
atcctggacagtgctgtcgaagagaacctccgactcactgctgcacccctcctcacaagg
gcagtgataaaggaaatgaccttcaagatggctgatgggcgtgaatatttacttcgcaag
ggtgacagaattgcaatctttcctttcagttctgtccaacatgacccagagatccatcct
gagccgcactcattcaaatatgaccgcttcctgaatccagacgggaccaagaaaactgat
ttttacaaagcgggaaagaaggtaaaatattacaccatgccctggggatccggggtctcc
atgtgccctggccgtttctttgccaccaatgagctgaaacagtttgttttcctcatgttg
gtctattttgaacttgagctgaagaatcctgatgagaagattcctgaaattgacctcagt
cgatacggctttggaacgatgcaacctgtcagagatgtccagttcagatacagactcaga
tattaa

DBGET integrated database retrieval system