KEGG   Oreochromis niloticus (Nile tilapia): 109201938Help
Entry
109201938         CDS       T06104                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109201938
   04020 Calcium signaling pathway
    109201938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:onl04040]
    109201938
Ion channels [BR:onl04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109201938
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 109201938
NCBI-ProteinID: XP_019213514
AA seq 449 aa AA seqDB search
MYSPAQESQWLDSVSLLIKDTLEGEMLMIDNLSGSVFHHYSSPQLICKDCKGHPQEQIRM
AEIEQASLKSEQLSDKSSSPALPDDLSLDEHTAYHLLAQEGEVKCSSDSPSSEEVEGGGH
QIQTVVQSQPCRALSTGIEMEIVLQEMEMQTHEPRVCSPQCSPAAIPVPPRSRSLRLSRG
LRLASRASRASWASFRSPGAHRKKLCTQYPSHSDSSLATGSSEGSLQTTLEEGLSFSVSP
PQNLDFPLSSAPLPLMCPLPLPEDTTSISSPVQTLRPRPSPSSGLTLLATRGHQRSQSSG
RGSTSPGYTRDDSIDPSDEDLGIGIGSSIGGCGSSQAGNSEHLSEALSSLSLTSLLSPSS
LVYPGGAVKKCNSTGSLDQGGMLLSSRSREGRREIMGLELMDPQGFLANPWTGVDTRRGE
GRGEIGDGDQGLKGKSSSQTTVGPCRKNR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtactcaccagcacaagagagccagtggttggacagtgtatctctcctgatcaaggat
accttagagggggagatgctgatgatcgacaacctctccggttctgtcttccaccactac
tcctctcctcagctcatctgcaaagactgcaagggccacccgcaagagcagatcagaatg
gcagagattgaacaggcttccctgaagtcagagcaactctcggacaagtcctcatcccct
gccctgccggatgacctcagcctagatgagcatactgcctaccacctgctggcgcaagag
ggcgaggtaaagtgcagcagtgactcacccagctctgaggaggtcgaaggaggaggtcac
cagattcagactgtggtgcagagccagccatgcagagccctcagcacgggcattgagatg
gagatcgtactgcaggagatggaaatgcaaacacacgaaccgcgtgtgtgttcacctcag
tgcagcccagcagccatcccagtacctccccgcagtagaagcctacgtttgtcaagaggc
cttaggctggcctcccgagcctccagagcctcgtgggcttcgttccgctcccctggagct
catagaaagaagctctgcacacagtacccctcccacagtgattcgtccctcgctacaggc
agctctgaaggcagccttcagaccaccttggaagaaggactgagcttcagtgtgtcccca
cctcagaacttagactttccactgtcatcagctccattgccgcttatgtgtcctctccct
ctgcctgaggacaccacctccatatcttccccagtccagaccctgagaccaagaccgagc
ccatcgtcgggtttaacccttctggccaccaggggtcaccagcggagccagagcagcggg
cgtggcagcaccagccctgggtacacccgcgatgactcgatcgacccttcagatgaggac
ctgggcatagggattggatcatctattggcggttgtggctccagccaagcaggcaacagt
gaacacttgtcagaggcacttagcagcttgtcgctgacatcactgctatcacccagctcc
ctggtgtacccaggaggagcagtaaagaagtgcaacagcacaggcagcctggaccaaggg
gggatgctgctgtcttcccggagcagggagggtcgtagggagattatgggtctggagctt
atggacccccaaggcttcttggccaacccctggacgggggttgatacaagaagaggagaa
ggaagaggggaaataggagatggagatcaaggactaaaggggaagagctcaagccaaaca
acagtagggccttgtcgaaaaaacagatga

DBGET integrated database retrieval system