KEGG   Oenococcus oeni: OEOE_0287Help
Entry
OEOE_0287         CDS       T00408                                 

Definition
(GenBank) D-alanyl transfer protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
ooe  Oenococcus oeni
Pathway
ooe00473  D-Alanine metabolism
ooe01100  Metabolic pathways
ooe01503  Cationic antimicrobial peptide (CAMP) resistance
ooe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    OEOE_0287
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OEOE_0287
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    OEOE_0287
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ooe01504]
    OEOE_0287
Enzymes [BR:ooe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     OEOE_0287
Antimicrobial resistance genes [BR:ooe01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    OEOE_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding DNA_pol_phi
Motif
Other DBs
NCBI-ProteinID: ABJ56266
UniProt: Q04H06
Position
276648..276881
Genome map
AA seq 77 aa AA seqDB search
MEKEVLAILENISGEDLSNQMDDNYFDNGLMDSMATVDLVLALQDKFGINVPVSEFDRSK
WDTPNKVIERVKELADN
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaagttttagcaattttagaaaatatttcgggtgaagatttatcaaatcaa
atggatgacaattattttgataacggtttgatggattcgatggcaacggttgatttggtt
ttggccttacaggataaattcggaatcaatgtgccggtttcggaattcgaccgtagcaaa
tgggatacgccgaataaagtaattgagagagttaaggagttagctgacaactaa

DBGET integrated database retrieval system