KEGG   Oenococcus oeni: OEOE_0330Help
Entry
OEOE_0330         CDS       T00408                                 

Definition
(GenBank) acetoin/pyruvate dehydrogenase complex, E2 component, dihydrolipoamide succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ooe  Oenococcus oeni
Pathway
ooe00010  Glycolysis / Gluconeogenesis
ooe00020  Citrate cycle (TCA cycle)
ooe00620  Pyruvate metabolism
ooe01100  Metabolic pathways
ooe01110  Biosynthesis of secondary metabolites
ooe01120  Microbial metabolism in diverse environments
ooe01130  Biosynthesis of antibiotics
ooe01200  Carbon metabolism
Module
ooe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0330
   00020 Citrate cycle (TCA cycle)
    OEOE_0330
   00620 Pyruvate metabolism
    OEOE_0330
Enzymes [BR:ooe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     OEOE_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 PTS_EIIA_1 GCV_H HlyD_D23 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: ABJ56305
UniProt: Q04GW7
Position
321201..322547
Genome map
AA seq 448 aa AA seqDB search
MTEIFKMPDIGEGMAEGEISDWLVKVGDQVKTDDSVAEVQNDKLLQEILSPYSGKVTKLF
VEPGTTVKVGEPLIEFDGDGSGSAADDGQKGKTEAKEIEEPAESEKKTAVSSQASPAAPT
SDSSNSSGAATASNGNILAMPSVRHYAHEHGIDLSQVTASGHHGHITMSDVENFSTSSAA
PEKEPENQPSEAETTTKQTASESAPTKKAAAPDPLKEGRVSMTPVRKAIAKAMSLQNSTI
PTVTNFDQTEVSKLVAHRKQFKPIAADQNIHLTYLAYAAKALAATAKKFPEINASLDMDK
QEIVYHDDINLGIAVNAPSGLYVPVIAHADQKSIMAIAQEIEDLAAAVRDGSIKPDQMRG
GTITISNIGSARGTWFTPIINAKEVAILGLGSIVKEPIISDDGTIVAGQMMKLSLSYDHR
LIDGMLGQTSMNYLKSLLADPAYMLMEV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatctttaaaatgcctgatattggcgaaggaatggctgagggagaaatttcc
gattggctggttaaagtcggcgatcaggtcaaaaccgacgattcggttgctgaagttcaa
aacgacaagcttctgcaggagatcctttcaccctattctggaaaagtcacgaagttattt
gttgaaccgggaacaacagtgaaagttggcgaacctctgattgagtttgatggcgacggt
agtggttcggccgctgacgatggccaaaagggaaaaacagaggccaaggaaatagaagaa
cccgcggaaagcgaaaaaaagacagcggtttccagccaagcatctccagcagctccaact
tctgattcttcaaatagcagcggagcggcaacagcttccaacggcaatattttggcaatg
ccgtcggttcgccactatgctcacgaacatggaatcgatttatcccaggttacggccagt
gggcatcacggccatattacgatgtccgatgttgagaacttttctacttcttctgctgcc
cctgagaaggaaccagaaaatcagccaagcgaggcagaaacaacgacaaaacaaacggct
tcggaatctgccccgactaaaaaagccgcagctcccgacccacttaaagaaggccgggtt
tcgatgacaccggttcgtaaggcgattgccaaagccatgtcgctgcaaaattctactatt
cctacagttactaattttgatcagactgaagtttcaaaactggttgcccatcgcaagcaa
ttcaagccgatagccgctgatcaaaatattcatttgacttatttggcatatgcggccaaa
gctttggcagctacggctaagaagtttccggaaatcaatgcatcgcttgatatggacaaa
caagaaattgtataccatgatgatattaatttgggaattgccgtgaatgcaccaagcgga
ttgtatgtaccggtgattgcccatgctgatcaaaaatcgattatggcaattgctcaagaa
attgaggatttggcagctgctgttcgtgatggttctattaagcccgatcaaatgcgtggc
ggaacaatcacgatttccaacatcggttctgcacgtggaacttggtttacaccgattatc
aatgctaaagaagttgcgattcttggtttaggatcgattgttaaagaaccgattatttca
gacgacggtacaatcgttgccggtcaaatgatgaaactcagtttgagttatgaccatcgt
ttgatcgacggcatgcttggtcaaacttcaatgaactatttgaagagcctgttagctgat
ccagcttacatgctgatggaggtgtaa

DBGET integrated database retrieval system