KEGG   Oenococcus oeni: OEOE_0529Help
Entry
OEOE_0529         CDS       T00408                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ooe  Oenococcus oeni
Pathway
ooe00071  Fatty acid degradation
ooe00072  Synthesis and degradation of ketone bodies
ooe00280  Valine, leucine and isoleucine degradation
ooe00362  Benzoate degradation
ooe00380  Tryptophan metabolism
ooe00620  Pyruvate metabolism
ooe00630  Glyoxylate and dicarboxylate metabolism
ooe00640  Propanoate metabolism
ooe00650  Butanoate metabolism
ooe00900  Terpenoid backbone biosynthesis
ooe01100  Metabolic pathways
ooe01110  Biosynthesis of secondary metabolites
ooe01120  Microbial metabolism in diverse environments
ooe01130  Biosynthesis of antibiotics
ooe01200  Carbon metabolism
ooe01212  Fatty acid metabolism
ooe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OEOE_0529
   00630 Glyoxylate and dicarboxylate metabolism
    OEOE_0529
   00640 Propanoate metabolism
    OEOE_0529
   00650 Butanoate metabolism
    OEOE_0529
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OEOE_0529
   00072 Synthesis and degradation of ketone bodies
    OEOE_0529
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OEOE_0529
   00310 Lysine degradation
    OEOE_0529
   00380 Tryptophan metabolism
    OEOE_0529
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OEOE_0529
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OEOE_0529
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OEOE_0529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ooe04147]
    OEOE_0529
Enzymes [BR:ooe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OEOE_0529
Exosome [BR:ooe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OEOE_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: ABJ56478
UniProt: Q04GE4
Position
511007..512161
Genome map
AA seq 384 aa AA seqDB search
MQKVFILSAVRTPIGKFGGVLKNKTAVELGATVIKSLLKRSEISAEEIDEIYMGNVIQAG
VGQNPARQSARLAGIPFSIPSTTINDVCGSGLHSINLAAKLIAGGFDDIIVAGGMESMSN
APFLLKNHRFGHKLGNEKIDDTLLRDALIDPIGNFHMGITAENIAERYSISRQSMDRYAL
ESHSRAVRAEKKGLFNDEIVAVDQVKQDQAPRADTSLEQLSKLKAVFKEGGKVTAGNASG
INDGAAGVILASERKVGELNLNPLAEWKFGNAVGVNPEIMGIGPVFAINDLYKKNNLSDQ
DIDLYELNEAYASQMLVDTSELHLNLNKVNPNGGSIALGHPVGASGARILVTLLYDLIHE
EKKRGIASLCVGGGMGVSTMIEKI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtatttattttaagtgcggttcgaacaccgatcggaaaatttggcggcgtt
ttaaaaaataaaacggctgttgaactcggagcaacggttattaaatcactgcttaagcgt
tcagaaatatctgccgaggaaatagatgaaatttatatgggtaatgttattcaagcaggc
gtcgggcagaatcctgctcgtcaatcagctcgtctagccggtattcccttttcaattccc
agcacgacaattaatgatgtttgtgggtcgggactgcattcgattaatttggcggctaaa
ttaatcgctggcggttttgatgacataattgtagccggaggaatggaatcgatgtccaat
gctccatttttgcttaaaaatcatcgatttggacataaattaggaaacgaaaagattgat
gatacattgttacgggatgctttgattgacccgatcggaaacttccatatgggtattaca
gccgagaacattgcagaaagatactctattagtcgtcaatcgatggatagatatgcgctt
gaatcgcattctcgggcagttagagccgagaaaaagggtcttttcaatgatgaaatcgtt
gctgtcgatcaagttaagcaagatcaagcaccaagagccgacacttctttagaacaattg
tcgaagttaaaggctgttttcaaagaagggggcaaagtcacagctggaaatgcttcggga
attaatgatggagctgctggagttattttagccagcgaaagaaaagtgggagaacttaat
ttgaatcctctagccgaatggaaatttgggaatgccgttggcgttaatccggagattatg
ggaatcggaccggtttttgcaattaatgatctgtataaaaaaaacaatctaagtgatcag
gatattgacttatacgagttaaacgaagcttatgcttcacagatgctggtcgatacgtcg
gaacttcatctgaatttaaacaaggttaatcctaatgggggatcaattgctttgggacac
ccggtgggtgcttctggcgcaaggattttagtcaccttattgtacgatctgattcatgaa
gaaaaaaaacgcggaattgccagtttatgtgtcggcggtggcatgggtgtttcaacaatg
attgaaaaaatttaa

DBGET integrated database retrieval system