KEGG   Oenococcus oeni: OEOE_0565Help
Entry
OEOE_0565         CDS       T00408                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ooe  Oenococcus oeni
Pathway
ooe00040  Pentose and glucuronate interconversions
ooe00052  Galactose metabolism
ooe00500  Starch and sucrose metabolism
ooe00520  Amino sugar and nucleotide sugar metabolism
ooe01100  Metabolic pathways
ooe01130  Biosynthesis of antibiotics
Module
ooe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OEOE_0565
   00052 Galactose metabolism
    OEOE_0565
   00500 Starch and sucrose metabolism
    OEOE_0565
   00520 Amino sugar and nucleotide sugar metabolism
    OEOE_0565
Enzymes [BR:ooe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OEOE_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABJ56510
UniProt: Q04GB2
Position
543073..543948
Genome map
AA seq 291 aa AA seqDB search
MVQKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDTPTIQFIVEEAIQSGIEDIVIVDGK
SKRSIEDHFDSNTELEDNLSAKGKDKLLKLVQDTTDLNIYFIRQSHPHGLGDAVLKAKSF
ISNEPFVVMLGDDLMTDRVPLTKQLVDRYNETEQSTLAVMPVPHEETSKYGVIDPSKEVK
PGLFEVKNFVEKPRPQDAPSDLAIIGRYLFTPTIFSELENTMPGKGNEIQLTDAIESLNH
KEHVYAHQFDGKRYDIGSKIGFLETNIEFGLKHPDTGDELRKYIKELAKTL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaaaagttaaaaaggccgtcattccggccgctggattgggcacacggtttttg
cctgcaaccaaggctttggcaaaggaaatgctgccaattgttgatacgccgacaatccaa
tttatcgttgaagaagcaattcagtcaggaatcgaagatatcgttatcgtcgacggaaaa
tcaaaacgatcaattgaagaccattttgattccaacacggaattggaagacaatttgtct
gccaagggtaaagacaagttattgaaattagttcaggatacgactgatttgaatatctat
ttcattagacagtctcatccacatggtttgggcgatgctgttttaaaggccaagtctttt
attagcaatgaaccctttgttgtaatgcttggtgatgatctgatgaccgatcgtgttcct
ttgactaaacaattggttgatcgttataacgaaaccgagcaatcgactttggcagtcatg
ccggttcctcatgaagaaacttcaaaatatggcgtaatcgatccttctaaggaagttaag
ccgggactgttcgaagttaaaaattttgttgaaaaacctcgtcctcaggatgcaccttcc
gatttggcaattattggtcgttacctatttacaccaacaattttttccgaactggaaaat
acaatgcccggcaagggcaacgagattcagttgactgatgcgattgaaagcctgaaccat
aaagaacatgtttacgctcatcaatttgatggtaaacgctatgatattggttcaaagatc
ggctttcttgaaacgaatattgaatttggattaaagcatcccgatactggcgatgaactt
cgcaagtatattaaagaacttgccaagactctttaa

DBGET integrated database retrieval system