KEGG   Oenococcus oeni: OEOE_0636Help
Entry
OEOE_0636         CDS       T00408                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ooe  Oenococcus oeni
Pathway
ooe00010  Glycolysis / Gluconeogenesis
ooe00030  Pentose phosphate pathway
ooe00500  Starch and sucrose metabolism
ooe00520  Amino sugar and nucleotide sugar metabolism
ooe01100  Metabolic pathways
ooe01110  Biosynthesis of secondary metabolites
ooe01120  Microbial metabolism in diverse environments
ooe01130  Biosynthesis of antibiotics
ooe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0636
   00030 Pentose phosphate pathway
    OEOE_0636
   00500 Starch and sucrose metabolism
    OEOE_0636
   00520 Amino sugar and nucleotide sugar metabolism
    OEOE_0636
Enzymes [BR:ooe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     OEOE_0636
Exosome [BR:ooe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OEOE_0636
  Exosomal proteins of other body fluids (saliva and urine)
   OEOE_0636
  Exosomal proteins of colorectal cancer cells
   OEOE_0636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: ABJ56578
UniProt: Q04G44
Position
598734..600050
Genome map
AA seq 438 aa AA seqDB search
MKVTFKKDYLKDFVADSEVELLKPTAGFVRDTLLARTGVGNEMEDWLTLPSDYDKEEFAR
ILKVADKIKSDSKVLVVIGIGGSYLGARAVIEFLKSEFHNEKANKEGLPEVYFVGTSASG
RYIDDVIDLIGNRDFSINIISKSGTTTEPAIAFRTFKSLIEKKYGKEEASKRIFATTDAH
KGALLNVAKENGYERFVVPDGIGGRYSVLSAVGLLPIAVAGINIQKLMDGAKAAQEEFAK
DEDILNKPSILYAIYRNILYRKGFDVETIVGYEPQFRFLFEWWKQLMAESEGKDNKGIYP
TSAIFSTDLHSIGQYIQDGKKILFETILDITKPISDRVVPSADDNTDNLDYILNKPMKEV
NEAALTATAQAHTSAGVPNILLQLDDLDEFNLGNLIYFFEAAVAVSGYLDGINPFDQPGV
EIYKTNMFKILGKPGYTD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttactttcaaaaaagattacttaaaagattttgttgccgattccgaggttgaa
ttgctaaaaccaacggccggttttgtccgtgacacattgcttgcccgtactggcgttggt
aatgagatggaggattggctgactttgccaagcgactacgataaagaagagtttgctcgg
attttaaaggtcgctgataaaattaagtctgattctaaagtcttggtcgtgattggaatt
ggcggttcttatctcggcgctcgagcagtaattgagttcttaaagtccgagttccataac
gaaaaggcaaataaagaaggtcttcctgaagtatatttcgttggtacttccgcttctggt
cgctatattgatgatgtaatcgatttgattggcaaccgtgatttttcgattaatattatt
tccaaatcgggaaccacaaccgagcctgcgattgctttccgtacttttaagagcttaatt
gaaaaaaagtatggcaaggaagaagccagcaaacgaattttcgcgacaactgatgctcat
aaaggtgcccttttgaacgttgcaaaagaaaatggctatgagcgtttcgttgttcctgat
ggtataggtggaagatactcagtattaagcgctgttggtcttttaccaattgccgttgct
ggaatcaacattcagaagttgatggatggcgccaaggcagcccaggaagaatttgccaaa
gacgaagatattctaaacaaaccatcgattctttatgcaatctatcgaaacattttgtac
cgaaaaggttttgatgtcgagacgattgttggttatgaaccacagttcaggttcttattt
gaatggtggaaacaattgatggctgagtctgaaggaaaagacaataagggcatttatcca
acctcagcgattttctcgactgatttgcattctatcggccagtacattcaagatggtaag
aaaattctattcgaaacgattttggatattaccaagccgattagcgatcgcgttgttcca
tcagctgatgataatactgataatcttgactatattttaaataagccgatgaaagaggtc
aatgaagccgcacttacagctactgcacaagcccacacttcggctggcgttccaaacatt
cttttgcagttggatgatctcgatgaatttaatttgggtaacctaatttatttctttgag
gctgctgttgcggtttccggttacttggatggtattaatccatttgatcagcccggtgtt
gaaatttataaaacaaatatgtttaaaattcttggcaaaccaggttatacagattaa

DBGET integrated database retrieval system