KEGG   Oenococcus oeni: OEOE_0769Help
Entry
OEOE_0769         CDS       T00408                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ooe  Oenococcus oeni
Pathway
ooe00670  One carbon pool by folate
ooe01100  Metabolic pathways
ooe01120  Microbial metabolism in diverse environments
ooe01200  Carbon metabolism
Module
ooe_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    OEOE_0769
Enzymes [BR:ooe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     OEOE_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS DUF4614
Motif
Other DBs
NCBI-ProteinID: ABJ56696
UniProt: Q04FS6
Position
717809..719470
Genome map
AA seq 553 aa AA seqDB search
MKSDIEIDHSIKALPITEIGKQIGLSDSQLIPYGHDKAKIDAYSIANMPRQGKLVLVTSI
NPTPAGEGKTTVTIGLVDAINRLGKSAIGALREPSMGPVFGLKGGATGGGYAQVIPMEDI
NLHFTGDIHAVSAAHNLLAAVIDNHLHQGNELKIDPENIYWRRVLDMNDRALRQITLGKG
RVNGPERNSGFDITASSEIMAVLTLSKNLFDLKKRLSRIVVALDVQGKPVTVADLKVAGA
LTAILKDAINPNLVQSLEHSPFIIHGGPFANIAQGTNSVVATDAALKLADFAVTEAGFGS
DLGGEKFMDVKVPVLGKEPDAVVIVATVKALKFHGGVALDHLSDKNVDAVRNGLDNLNRH
LEAMTHYGKPVVVALNKFLDDDMEEIQLIKNFVEGEKKLQFEIVTSFVDGFEGSLDLAKK
VIEATDNQRFFMPLYQADDSIENKIQTIVEKIYGGKDFELSDRAKKDLAEVKENGWGKLP
VVIAKTPNSLTDDSKIHGAPTGFTIHIRRFIPKIGAGFIVAMAGKVLMMPGLGKNPAAEK
IDVDENGKISGLS
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagatattgaaattgatcatagtatcaaagcgcttccgattacagaaattggc
aagcagattggtttatcggattctcaactgataccttatgggcatgataaggcaaaaatt
gatgcgtacagcattgcaaatatgccccggcagggtaaattggttcttgtcacgtcaatt
aatccaactcccgccggcgaaggaaaaacaactgtcacaatcggtctggtcgatgcgatt
aatcgtttgggaaaatctgcgattggtgctcttcgggaaccttcgatggggccggttttt
ggtctcaaaggcggtgcgaccggcggcggttatgcccaggttattccaatggaagatatt
aatttgcattttaccggcgatatacatgctgtctcggcagctcataatctgcttgcagct
gtgatcgataatcatttacatcaggggaatgaattaaaaatcgatcctgaaaatatttat
tggcgccgggtactcgatatgaatgatcgcgctcttcgccaaattacccttggaaaaggt
cgagttaatggtccggaacgaaattccggctttgatattactgccagttctgaaattatg
gctgttttgactctttcaaagaatctttttgatttgaaaaaacgtttgagccgaatcgta
gtagccttggatgtccagggaaagccggttacagttgcagatctaaaagtggctggcgcg
ttaactgcgatcctaaaggatgcgattaacccgaatctggttcaatcgctagaacattct
ccttttattattcatggcggaccttttgcgaacattgcccaaggaactaattcagttgtt
gcaacggatgctgctctcaagctggctgattttgccgtgacggaagcaggttttggttca
gaccttggcggggaaaagttcatggatgttaaagttcctgttttgggtaaagaacctgat
gctgtcgtaattgttgccaccgttaaggctctgaagtttcatggtggggtggcgctcgat
catttgtcggataagaatgtcgatgctgttagaaacggattggataatttgaataggcat
ttagaagcgatgacacattacggcaaaccggttgttgttgctttgaacaaattccttgat
gacgatatggaagaaattcagctgatcaagaatttcgttgaaggtgaaaagaaactacaa
tttgagattgtcactagttttgttgatgggtttgaagggtctttggatttagccaaaaag
gttattgaagcgaccgacaatcaacgattctttatgccactttatcaggccgatgattcc
attgaaaataaaattcaaacaattgtcgaaaagatatatggcggcaaggatttcgaatta
tctgatcgtgctaaaaaagacttagccgaagtcaaagaaaacggctggggcaagttacct
gttgtgatcgccaaaacgcccaacagcctgaccgatgatagcaagattcatggcgcaccg
actggcttcacgatccatattcgccgctttattccgaaaatcggcgctggttttattgtt
gcgatggcaggcaaagttttgatgatgcctggtttaggaaaaaatccagctgccgaaaaa
attgatgtagatgagaacggcaagattagtgggttaagttaa

DBGET integrated database retrieval system