KEGG   Oenococcus oeni: OEOE_0897Help
Entry
OEOE_0897         CDS       T00408                                 

Definition
(GenBank) UDP-N-acetylmuramyl tripeptide synthase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ooe  Oenococcus oeni
Pathway
ooe00300  Lysine biosynthesis
ooe00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OEOE_0897
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OEOE_0897
Enzymes [BR:ooe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     OEOE_0897
Peptidoglycan biosynthesis and degradation proteins [BR:ooe01011]
 Precursor biosynthesis
  Amino acid ligase
   OEOE_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C tRNA-synt_1g
Motif
Other DBs
NCBI-ProteinID: ABJ56814
UniProt: Q04FF8
Position
839870..841369
Genome map
AA seq 499 aa AA seqDB search
MREDFTNEIVTESLNEAGILVEKPSEIRRHFDDLQFDSRKVTKKNTLFVVKGAFKIEYLT
ASLLDKISGIVTSRKEKINIPNLPHWIVSNSQIALAVLSAEFFGHPEKKLKILGITGTKG
KTSSTYMAYSLLDRLTNHQTAMFSTIDTFLGRGIKFKSELTTPESYELFSNMKKALDNGN
KYLVMEVSSQSYLKNRVFGIHFKVGAFLNISPDHIGINEHPTFADYLAHKKMLAENSDVF
VSNIDDAHGQEFIDHAKSFGAKTVSVSENKKADVNFHIKKADLDESIFYLTEKGNSQEFL
LDIPGVFNIYNASVAIAMVREMGFKPEKAKKALAELQIPGRMVKIKTKSHGLIIVDYAHN
GQAVTTLLTFLKSQHQGGKIIIVLGSPGDKGEDRRSQFGEVISKFVDVAYLTTDDPGTED
PHQINNQIRKAISNPNVELHEELDRSKAIQEAIKKANINDLVVLAAKGEDAFQKTNHVDV
PYLGDKKVAEEFLAEIEKV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagattttacaaatgaaattgttactgaatcgctgaatgaagcgggtattcta
gtggagaaaccttccgaaataaggcggcactttgatgatttacaatttgattctcgtaaa
gtcacaaagaagaacacacttttcgtcgtaaaaggcgcttttaaaatagaatatttaaca
gcttctttacttgataaaatttccggcattgtgacgagtcggaaagaaaaaataaatatt
ccgaatttgccgcattggattgtttctaattcacaaattgctttggcggttctgtctgca
gaattttttggccatccggaaaagaagttgaaaattctcggaatcacgggcacaaaagga
aaaacgagttctacttacatggcctatagtcttttagatcggctgaccaaccatcaaact
gctatgttctcaacgatcgatacctttttaggtcggggaattaaatttaaaagcgaattg
acaaccccggagtcttatgaacttttctccaatatgaaaaaagcactcgataacggtaat
aagtacttagtgatggaagtcagttcccagtcctatttaaaaaatcgcgtttttggaatt
cattttaaagtgggtgcctttttaaatattagtcctgaccatattggtattaatgagcat
ccaacctttgctgattatttggctcataaaaaaatgcttgcggagaattccgacgttttt
gtctcgaatatcgatgatgctcatggacaggaatttattgatcatgcaaaatcttttgga
gcaaaaacagtttctgtttccgaaaataaaaaagctgatgtcaatttccatattaaaaaa
gcggaccttgacgaatcgattttctatttaacagaaaaagggaatagtcaagaattctta
ttggacattcctggtgtttttaatatctataatgcttcggttgcaattgcaatggttcgc
gaaatgggttttaaaccggaaaaagctaaaaaagcactggcagaattgcaaatccctggt
cgaatggtgaaaataaagaccaaatcgcatggtttgatcattgttgattacgcccataac
ggtcaagctgtcacaactttattaactttcttgaaatctcagcatcaaggaggcaaaatt
atcattgttctcggatctccaggagataaaggcgaagatcgtcgttctcaattcggtgaa
gttataagtaaatttgtcgatgttgcatatctaacgactgatgatccgggtaccgaggat
ccacatcaaataaataatcagattagaaaagcaatcagcaatccgaatgtcgaacttcac
gaagaactcgatcgcagcaaagcaattcaggaggcaattaaaaaagcaaatataaatgac
ctggttgttctggcagccaaaggggaagatgcctttcaaaaaacaaatcacgtcgatgtt
ccttatcttggagataaaaaggttgctgaagagtttttagccgaaattgagaaagtctga

DBGET integrated database retrieval system