KEGG   Oenococcus oeni: OEOE_0950
Entry
OEOE_0950         CDS       T00408                                 

Definition
(GenBank) tRNA delta(2)-isopentenylpyrophosphate transferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
ooe  Oenococcus oeni
Pathway
ooe01100  Metabolic pathways
ooe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ooe01006]
    OEOE_0950
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ooe03016]
    OEOE_0950
Enzymes [BR:ooe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     OEOE_0950
Prenyltransferases [BR:ooe01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   OEOE_0950
Transfer RNA biogenesis [BR:ooe03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    OEOE_0950
 Prokaryotic type
    OEOE_0950
SSDB
Motif
Pfam: IPPT IPT AAA_33 TIP49 Cytidylate_kin AAA_18 T2SSE
Other DBs
NCBI-ProteinID: ABJ56862
UniProt: Q04FB0
Position
889820..890593
AA seq 257 aa
MSDPHLKEKVVVIAGPTASGKSDLAIKIAQMIDSEIISEDAFQIYRGLDIGTAKPSKDDL
AKVKHHFIDIKEVDESYSAYEFARDARIVINQISSKKKIPLIVGGSGFFLQTLLGDRRIS
DKDNPIVPKKAGIENRLYNALLIGLNTERSQLYDRINQRVERMFEKGIVKEAENLFRQQG
NFQSKKAIGYREFAGYFANQYDLSEVETLIKRDSRRYAKRQLTYFKNQFPDMRWFDTKQI
TENPKLIIDLVKKFNQF
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagtgatccacatttgaaagaaaaagttgttgtaattgctggaccgaccgctagtgga
aaaagtgatctggcaattaaaattgcccagatgattgacagtgaaattatttccgaagat
gcctttcaaatttatcgtggtttggatattggaacggcaaagccgagtaaagatgattta
gcaaaggttaaacatcattttatcgatatcaaagaagtcgacgaatcctacagtgcctat
gaatttgcaagagacgcacgaatagttatcaatcaaatatcgtctaaaaagaagattcct
ttgattgtcggtggatctggcttttttttgcagacacttttgggcgatcggagaatttct
gataaggataacccaattgttcctaaaaaagccggaatagagaatcgtctttataatgct
ttgttgattggtttgaacacagaacgttcacagctttatgatcggattaatcaacgggtt
gaaaggatgtttgaaaagggaattgtgaaagaagccgaaaatctttttcgtcaacaaggt
aattttcaatcaaaaaaagcaattggatatcgtgaatttgctggatacttcgctaatcag
tatgacttgtcggaggttgaaactttaattaagcgcgattctcgaagatatgcaaaaaga
caattgacttattttaaaaatcaatttcccgatatgcggtggttcgatacaaaacagatt
accgaaaatcccaaattaattattgatttagtaaaaaaatttaaccaattctag

DBGET integrated database retrieval system