KEGG   Oenococcus oeni: OEOE_1330Help
Entry
OEOE_1330         CDS       T00408                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ooe  Oenococcus oeni
Pathway
ooe00010  Glycolysis / Gluconeogenesis
ooe00071  Fatty acid degradation
ooe00625  Chloroalkane and chloroalkene degradation
ooe00626  Naphthalene degradation
ooe01100  Metabolic pathways
ooe01110  Biosynthesis of secondary metabolites
ooe01120  Microbial metabolism in diverse environments
ooe01130  Biosynthesis of antibiotics
ooe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_1330
  Lipid metabolism
   00071 Fatty acid degradation
    OEOE_1330
  Amino acid metabolism
   00350 Tyrosine metabolism
    OEOE_1330
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OEOE_1330
   00626 Naphthalene degradation
    OEOE_1330
Enzymes [BR:ooe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OEOE_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ABJ57199
UniProt: Q04EC3
Position
complement(1237877..1239019)
Genome map
AA seq 380 aa AA seqDB search
MNSSQNEFVDVLFEKEVMLMKPENTFNSKESVDVGGSERIPSEMRAWEVTSPAPIDSSPS
PIHFVKHPVPVPKTSEVLVRVISCGICHTDLHVAEGDLPVHHPHVIPGHEIIGRVVANGP
QAGRFNLGDRIGVPWLRWTCGVCTYCRSGKENLCPNSLYTGWDHDGGYAEYVTVPEGFAY
RIPSAFNSVTAAPLLCAGIIGYHAFRRANVPAGGRLGLYGFGGSAHLAAQIAIAQGIEVH
VFTRGKDAQRFALELGAASAQGVYDPSPVSLDSSILFAPVGDIVPKALENLAAGGTLALA
GIHLTDVPSLNYQNHLFHEKVLTSVESNTRRDGEEFLTLADRLKIHPKTTEYPFEKADEA
LRHLSHGDMQGACVLRISEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaagccaaaatgagtttgttgatgttttatttgaaaaagaggttatgcttatg
aaacctgaaaatacttttaattcaaaagaatctgttgatgttggcggttctgaaagaatt
cccagcgaaatgcgagcttgggaagtgactagcccagcgccaattgatagctcgccatcg
cccattcattttgtaaaacatccggttccggtccctaaaaccagtgaagtgttggttcgg
gttatttcgtgcggtatttgccacactgatctgcatgttgccgaaggtgatcttccggtt
catcatccccacgtaattcccggccatgaaattattgggcgggtcgtcgcgaacggccca
caagcaggtcgttttaatttaggcgatcggattggagttccttggttgcgttggacctgc
ggcgtatgtacttattgccgatccggcaaagagaatctttgtcctaattcgctttatact
ggttgggatcatgatggagggtatgccgaatatgtgactgttccagaaggatttgcttat
cggattccgtctgcttttaactcggtcactgctgcgccgctgctttgtgccggcatcatt
ggctatcatgcttttcgtcgggcaaatgttccggccggaggccgcctaggtctttatggt
tttggtggttctgctcatctggcagctcagattgccattgctcaaggtattgaagtccac
gtattcacgcgtggaaaagacgcacagcgttttgctttggaactaggtgcggcgtcggcc
cagggcgtttacgacccatctccggtctctttggattcatcaattctttttgctccggtt
ggcgatatcgtgccgaaagctttggaaaatttggcagccggcgggacattagcactagcc
ggtatccatttaaccgatgttccttcgctgaactaccagaatcatttgtttcatgaaaaa
gttcttactagtgttgaaagtaatacacgtcgcgatggtgaagaattcctgactttggcc
gatcgattgaagattcatccaaaaacaactgagtatccttttgaaaaagccgatgaagcg
ctgcgccatttgtcgcacggcgatatgcagggcgcctgtgttttgcgcatcagcgaagga
tga

DBGET integrated database retrieval system