KEGG   Orcinus orca (killer whale): 101269823Help
Entry
101269823         CDS       T05247                                 

Gene name
PARP9
Definition
(RefSeq) poly [ADP-ribose] polymerase 9 isoform X2
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101269823 (PARP9)
Enzymes [BR:oor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101269823 (PARP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP PH_13
Motif
Other DBs
NCBI-GeneID: 101269823
NCBI-ProteinID: XP_004278612
Position
Unknown
AA seq 811 aa AA seqDB search
MDFSKGVGAAAYNEKSEIDNLRENYSRQISINHNEFKILKNNESQLWEVLQKKFSCIFTL
VSPAQEGNCESLQVFRKMLAPRLELSVWKDDLTRHVVDVVVNAANEDLIHGGGLAQALVK
AGGLEIQEESRRYVSFYGKIPTGGIAITGAGKLPCKLIIHAVGPRWGLMDRQECFEKLRR
AIINILDFVNSNECTETVAIPALSSGIFQFPLDLCTQVIVETIKRYFQNMQLANNLKEIH
LVSNEDPTVAAFKTISEAILGRNELGSRVSQEATDLFNTMVVNNLTLQIVQGHIEMQETN
VIVNSVYTHGGLRATSVSKSILQAAGDEIEREFSQNMTKTPLDSQLVLVTKGFKLPCKYV
YHVLWPSGYSEQKLTLETAMKKCLGKCLELNITSISFPALGTGISEAAEIMFNEVLMFAR
HHLQQLTVKFVIFPKEQQLYKVFSTEMEKNKLKLQGLNNYPGVPQGTREKRENRFPVLNL
MGSDQEKIDEAQAWIQRILTLQDYHIIEDMHILYLGKKKHDYLSELQKTSCVSISEMISP
GKAQLEIKGAQADLFKAVMNIELMLCEVQEEMARKKERILWSLSGQQTDQQPENQNPMKE
NALLKCLKISTREIQDQKKQFEDCGLWVIKVEKVDNALLMAAFQRRKKMMEERTHGKPVS
HRLFQQVPHQFCKMVCRVGFHRMYSVPCDPKYGAGIYFTKNLKNVAHQIKKTSATDKLIY
VFEAEVLTGSFCKGHELNIVPPPLHPGAVDCHDSVVDNVSSPETFVIFSDTQAVPQYLWT
CTQNHVQDYSGQMMLSPQQPWRKLSSGSSVD
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggacttttccaagggtgtcggagcagcagcttacaatgagaaatcagagattgataat
ctcagagaaaactacagtcggcaaatttccattaatcacaatgagttcaaaattttaaaa
aataatgagagtcagctgtgggaagtcctccagaaaaaatttagctgtatctttacccta
gtttctccagcccaggaaggtaactgtgagtctctacaagtcttcagaaaaatgctggcg
cccaggctagagttatctgtctggaaggatgacctcaccagacatgttgttgacgttgtg
gtgaatgcagccaatgaagacctcattcatgggggaggcctggcccaggccctcgtgaaa
gctggcggccttgaaatccaagaggagagcagaagatatgtttccttttatggcaaaatt
ccaactggtggcatagctatcacaggagcagggaagcttccctgcaaactcattatccat
gctgttgggcctcggtgggggttaatggatagacaggaatgtttcgaaaaactgcgtaga
gccattataaatattttggattttgtcaatagtaatgagtgcactgagacagtagctatt
ccagccctgagctctgggattttccagttccctctggatttgtgtacacaggtcattgtg
gaaactatcaagcgttatttccaaaacatgcaactagccaataatttgaaagaaattcac
ctggtaagcaatgaggaccctactgttgctgcctttaaaaccatttcagaagccatccta
gggagaaacgagctggggtcccgggtgagtcaagaagccaccgaccttttcaatactatg
gttgtgaacaacctgactctccagattgtccagggccacattgaaatgcaggaaacaaat
gtaattgttaattctgtatatacacatggtggtcttagagccacatctgtgtcaaaatca
attctacaagcagcaggagatgaaatagaaagggaatttagccaaaatatgactaaaaca
ccactagattcccagttggtactggtcacaaaaggatttaaattgccctgcaaatacgta
taccatgtgttgtggccttcaggatattctgaacaaaaactgacattggaaactgcaatg
aagaaatgcttgggaaaatgccttgagctaaatataacttccatttcctttcctgccctt
gggactggaatctctgaagcagcagagattatgtttaatgaagttttaatgtttgccaga
caccatttgcaacaattaactgtaaagtttgtgatcttcccaaaagaacagcagttatat
aaggttttcagcactgaaatggaaaagaataagttgaagctgcagggtctcaacaattac
cctggtgtcccccaggggaccagagagaagagagaaaatagatttcctgtcctcaatctg
atgggatccgatcaggaaaagatagatgaggcccaagcgtggatccagaggatactgacc
ctccaggactaccacatcattgaggatatgcatatcctctacctcgggaaaaagaaacat
gactatttgtctgagcttcagaaaacctcatgtgtctctatctcagagatgatcagcccg
ggaaaagcacagttagagattaaaggagcccaggctgacctctttaaggcagttatgaac
attgaactaatgctgtgtgaagttcaagaggaaatggcaagaaaaaaggagcgcatcctt
tggagcttgtcagggcagcagactgatcagcaaccagaaaaccagaatccaatgaaggaa
aatgcacttttgaaatgcctgaagatttcaactcgagaaattcaggatcaaaagaaacag
tttgaagactgtggtttgtgggttataaaggtggagaaggtagacaatgcacttctcatg
gctgccttccaaagaaggaagaaaatgatggaagagagaacccatgggaaacctgtgagc
cacaggttgtttcagcaagtcccacaccagttctgcaaaatggtatgcagagtcggcttt
cacagaatgtactccgtgccctgcgacccaaaatatggagctggaatatacttcaccaag
aacctcaaaaacgtagcacaccagatcaagaaaacatctgccacagataagctgatctat
gtgtttgaggctgaagtactcacaggctccttctgcaagggtcatgagttaaatattgtt
cccccacccttgcatcctggagccgtagactgccatgacagtgtggttgacaatgtttcc
agccctgaaacctttgtcatttttagtgacacacaggctgtgccccagtatttgtggact
tgcacccaaaatcatgtacaggattactcaggacaaatgatgctgtctccacagcagcct
tggaggaaactctcaagtggcagctctgttgattaa

DBGET integrated database retrieval system