KEGG   Orcinus orca (killer whale): 101272142Help
Entry
101272142         CDS       T05247                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04218  Cellular senescence
oor04370  VEGF signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04722  Neurotrophin signaling pathway
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101272142 (MAPKAPK2)
   04370 VEGF signaling pathway
    101272142 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101272142 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101272142 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101272142 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101272142 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101272142 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101272142 (MAPKAPK2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101272142 (MAPKAPK2)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101272142 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 101272142
NCBI-ProteinID: XP_004282470
Position
Unknown
AA seq 414 aa AA seqDB search
MLSNSGAVPQPAAAAATAPCCPTPAMFPNPPPPPPQPPAPAQPHPPAQPPPQPPQQFPQF
HVKSSLQIKKNAIIDDYKVTTQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVE
LHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEI
MKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYT
PYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKSRIRMGQYEF
PNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDK
ERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaactccggtgctgttccccagcccgccgccgccgccgccaccgcaccatgc
tgtccaacgccggcgatgttccccaacccgccgccgccgccgccgcagccccccgccccg
gcccaacctcaccccccggcccagccgccgccgcagcccccgcagcagttcccccagttc
cacgtcaagtcgagcctgcagatcaagaagaacgccatcatcgacgactacaaggtcacc
acccaggtcctgggactgggcatcaacgggaaagttttgcagatcttcaacaagaggacc
caggagaaattcgccctaaaaatgctgcaggactgccccaaggcccgccgggaggtggag
ctgcactggcgggcttcccagtgcccacacattgtgcggatcgtggacgtctatgagaac
ctgtacgcggggaggaagtgcctgctgattgtcatggagtgtttggatggtggagaactc
ttcagccgaatccaggaccgaggagaccaggcattcacagaaagagaggcatcagagatc
atgaagagcatcggcgaggcgatccagtacttacactcaatcaacattgcgcatcgggat
gtcaagcctgagaatctcttatacacctccaaaaggcccaacgccattctcaaactcact
gattttggctttgccaaggaaaccaccagccacaactctctgaccactccttgttacacg
ccatactatgtggctccagaagtgctgggcccagagaagtatgacaagtcctgtgacatg
tggtccttgggtgtcatcatgtacatcctgctgtgtgggtatccccccttctattccaac
catggccttgccatctctccgggcatgaagagtcgcatccgaatgggccagtatgaattc
cccaatccagaatggtcagaagtatcagaggaagtgaagatgctcatccggaacctgctg
aagacagagcccacccagaggatgaccattaccgagttcatgaaccacccctggatcatg
caatcaacaaaggtccctcagaccccactgcacaccagccgggtcctgaaggaggacaag
gagaggtgggaggacgtcaaggaggagatgaccagtgccttggccacgatgcgggtcgac
tatgagcagatcaagataaaaaagattgaagacgcatccaaccctctgcttctgaagagg
cggaagaaagctcgggccctggaggccgcggccctcgctcactga

DBGET integrated database retrieval system