KEGG   Orcinus orca (killer whale): 101272361
Entry
101272361         CDS       T05247                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101272361 (RDH5)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101272361 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 101272361
NCBI-ProteinID: XP_004274246
Position
Unknown
AA seq 318 aa
MWLPLLLGVSLWAALWLLRDRQSLPASDAFVFVTGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLERVASSRLHTTLLDVTDPQSVRQAAKWVETHVGEAGLFGLVNNAGTAGIIGP
TPWQTQEDFQRVLNVNTLGPIGVTLALLPLLRQAQGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLESLEDSLQACWARLPSATQALYGET
FLTKYLRVQQRIMNLICDPDLTKVSKCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttcttggagtctcgctctgggcagcactgtggttgctcagggac
cggcagagcctgcccgccagcgatgctttcgtctttgtcaccggctgtgactcgggcttt
gggcggcttctggcactgaggctggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctcgagcgggtggcctcctcccgactccacaccaccctg
ctggatgtcacagatccccagagcgtccggcaggcagccaagtgggtggaaacacacgtc
ggggaagcagggctttttggtctggtgaataatgccggcacggctggcatcatcgggccc
acaccttggcagacacaggaggatttccagcgggtgctgaatgtgaacacactgggtccc
atcggggtcaccctcgccctgctgcccctgctgcggcaggcccagggccgggtgatcaac
atcaccagtgtgctgggccgcctggcagccaatggaggaggctactgtgtctccaagttt
ggcctggaggcgttctctgacagcctgaggcgggacgtggctcctttcggggtacgagtc
tctatcgtggagcctggcttcttccgaacccccgtgacaaacctggaaagtctggaggac
agcctgcaggcctgctgggcacggctgccttcagccacacaggccctctatggggagacc
ttcctcaccaaatatctgagagtgcagcagcgcatcatgaacctgatctgtgacccggac
ctgaccaaggtgagcaagtgcctggagcatgccctgactgcccgtcaccccagaacccgc
tacagcccaggctgggacgccaagctgctctggctgccagcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgctcaggcggtctactga

DBGET integrated database retrieval system