KEGG   Orcinus orca (killer whale): 101274526Help
Entry
101274526         CDS       T05247                                 

Gene name
ACVRL1
Definition
(RefSeq) serine/threonine-protein kinase receptor R3
  KO
K13594  activin receptor-like kinase 1 [EC:2.7.11.30]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101274526 (ACVRL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101274526 (ACVRL1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101274526 (ACVRL1)
Protein kinases [BR:oor01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   101274526 (ACVRL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS APH DUF4381 Pkinase_fungal Alpha_GJ
Motif
Other DBs
NCBI-GeneID: 101274526
NCBI-ProteinID: XP_004274350
Position
Unknown
AA seq 504 aa AA seqDB search
MTLDPPRRTLLMLLTALGLTQGDPVKPSRGPLVTCTCENPHCKGPTCQGAWCTVVLVREE
GTHLQEHRGCGNLNQELCKGRPTEFFNHYCCYSPFCNHNVSLVLEATQTPPEPPQEDGQL
PLILGPVLALLVLVALGALGLWHVRRRQEKQRSLNSELGESSLILKASEQGDSMLGDLLD
SDCTTGSGSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSW
FRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLA
LRLAVSAACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQGS
DYLDIGNNPRVGTKRYMAPEVLEEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVE
DYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSAR
LTALRIKKTLQKLSNGLQRPKGIH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaccttggaccctcccaggagaacccttctgatgctactgacggccttgggcctgacc
cagggcgaccccgtgaagccctctcggggcccgctggtgacctgcacgtgtgagaaccca
cactgcaaagggcctacctgccagggggcctggtgcacagtagtgctggtgcgggaggag
ggcacacacctccaggaacatcggggctgcgggaacctgaaccaggagctctgcaagggg
cggcccaccgagttcttcaaccactactgctgctacagccccttctgcaaccacaacgtg
tccctggtgctggaggccacccagactccgccagagccgccgcaagaagatggccagctg
cctctcatcctgggccccgtgctggccttgctggtcctagtggctctgggtgccctgggc
ctgtggcatgtccggcggaggcaggagaagcagcggagcctgaacagcgagctgggcgag
tccagcctcatcctgaaggcatccgagcagggggacagcatgctgggggacctcctggac
agtgactgcaccaccggcagtggctcagggctccccttcctggtgcagaggacagtggcg
cggcaggtggctctggtggagtgtgtgggaaagggccgctatggcgaggtatggcggggc
ctgtggcacggtgagagtgtggccgtcaagatcttctcctcgagggatgaacagtcctgg
ttccgggagactgagatctacaacacggtgctgctcagacacgacaacatcctaggcttt
atcgcctcggacatgacttcccgcaactcaagcacgcagctgtggcttatcacgcactac
cacgagcatggctcgctctacgactttctgcagaggcagacgctggagccccagctggcc
ctgaggctagccgtgtccgcggcctgcggcctggcgcacctgcacgtggagatcttcggc
acgcagggcaagccggccatcgcccaccgcgacctcaagagccgcaacgtgctggtcaag
agcaacctgcagtgctgcatcgcggacctgggcctggctgtaatgcactcccagggtagt
gactacctggacatcggcaacaacccgcgcgtgggcaccaagaggtacatggcccccgag
gtgctggaagagcagatccgaaccgactgcttcgagtcctacaagtggacggacatctgg
gcctttggcctggtgctgtgggaaatcgcccgccggaccattgtcaatggcatcgtggag
gactacaggccccccttctatgatgtggtgcccaatgaccccagctttgaggacatgaag
aaggtggtgtgtgttgaccagcagacccccactatccccaaccggctggctgcagacccg
gtcctctcaggcctggctcagatgatgcgggagtgctggtacccaaacccctctgcccgc
ctcactgcgctgcggatcaagaagacactgcagaagctcagcaacggtctccagaggccc
aaagggattcactag

DBGET integrated database retrieval system