KEGG   Orcinus orca (killer whale): 101274865Help
Entry
101274865         CDS       T05247                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: olfactory guanylyl cyclase GC-D-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00230  Purine metabolism
oor01100  Metabolic pathways
oor04740  Olfactory transduction
oor04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101274865
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    101274865
   04740 Olfactory transduction
    101274865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101274865
Enzymes [BR:oor01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101274865
Protein kinases [BR:oor01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   101274865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 101274865
NCBI-ProteinID: XP_012392147
Position
Unknown
AA seq 625 aa AA seqDB search
MTILIVNTLHILVFTTALPGNGNPILPQAQAPSSPHTPHPACPRRLSLGYCSGLPAGLLA
SALVLDLTVAGKQPPGGFLALALTCVLVLAGRPSLASSEISRLSIQQLQLVRGPYWILLT
AQELTFIHRPLSRWMRELWHENIATFLGFFVAPGVSALLLEHCARGSLEDLLRNEALRLD
WTLKASLVLDMIRGVWYLHHRHFPHGCLKSRNCVVAGCFVLKVTDHGYAELLDAQWAPRP
RPAPEELLLTAPELLRGPGAPGRGTLKGDTFSVGIILPEVLTWGPHYGSPGLSAEEIIRK
VVSPPRLCRPLVSPDHGPPECIQLMELCWEEAPEDRPNLDQIYTQFKSINQGKKTSIADS
MLQMLEKYSQNLEDLIQEWTEELGLERQKMERLLSQMLLPSVAEALKMGATVEPEYFDQV
TIYFSDTVGFTTISALSEPIEVVGLLNDLYTLFDAVLGNHDMYKVETIGDAXMVATGLPQ
RNRSQHAAEITNMALDILSSVGDFRMRHVPTVSIRIRAGLHSEPCMAGVVGLTMSQYCLS
GDTVNTTSRMESTGIPYRIHVCISTAQTLLSLDEGYRIDIRGQTELKGRGFKETYWLGGK
AGFPRRLPTPLDIKPRVMDEIVLPP
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgactatcctcattgtaaatacgctacacattttagtcttcaccacagctctgccaggt
aatggcaaccccatcctcccccaggctcaggcaccctcgtctcctcacaccccacaccca
gcctgcccccgtcgtctctcgctaggttactgcagcggcctccctgcaggcctccttgct
tctgctcttgtcctggacctcaccgtggcaggtaagcagcccccaggcggcttcctcgct
ctggccctgacctgtgtcttggtgctggccggcaggccctcacttgcctcatcagagatc
tccagattgagcatccagcagctgcagctcgtgcggggcccctactggatcctgctgaca
gcccaggagctcaccttcatccaccggcccctgagcagatggatgcgggagctgtggcat
gagaacattgccaccttcctgggcttctttgtggcccctggggtcagtgctcttttgttg
gagcactgtgcccggggcagcctggaggacctgctgcggaatgaggctctgcggctggac
tggactttgaaggcctccctggtgctggatatgatccgtggtgtgtggtatctgcaccat
cggcatttccctcatggctgcctcaagtcccgaaactgtgtggtggctggatgctttgtg
ctgaaggtcactgaccatggttatgcagagctcctggacgctcagtgggctccccgcccc
cggccagccccggaggagctgctgttgacagctccggagctgctgcgggggcccggggca
cccgggcggggcaccctcaaaggagacaccttcagcgtcggcatcatcctgccggaggtg
ctgacttggggcccgcactatggttccccagggctctcagcggaagaaatcatcaggaag
gtggtgtctccccctcgcctgtgccggccactggtgtctcctgaccacgggccacctgag
tgcatccagctgatggagctgtgctgggaggaggctccggaggacagacccaacctggac
cagatctatacccagttcaaaagcatcaaccaaggcaagaagaccagtattgctgactct
atgctgcagatgctggagaagtattcccagaacctggaggacctgatccaggagtggact
gaggagctggggttggagagacagaagatggaaaggttgctctctcagatgctcctgccg
tctgtggctgaagctctgaaaatgggggcgactgtggagccagagtactttgaccaggtt
accatatacttcagtgacactgtaggctttaccaccatctcagccctgagtgagcccatt
gaggtggtgggcttgctcaatgacctctacacactgtttgatgctgttctgggcaaccat
gacatgtataaggtggagaccatcggggatgcctaaatggtggcaacagggctgccccag
cgcaacaggagccagcatgcagctgagatcaccaacatggccttggacatcctcagctct
gtgggcgacttccggatgaggcatgtgcccactgtgtccattcgcatcagggctggactg
cattcagagccctgcatggcgggggttgtgggtctcaccatgtctcagtactgcctctct
ggggacacagttaacaccacatcccggatggagtctacagggataccatacagaattcat
gtctgcataagcaccgcccagacactgctcagcctggatgaaggctacagaattgatatc
agaggccagacggagctaaaggggaggggcttcaaggagacctactggctgggggggaag
gcgggcttccccagacgcctccccacacctctggacatcaaaccccgggtcatggatgag
atcgtgctgcctccataa

DBGET integrated database retrieval system