KEGG   Orcinus orca (killer whale): 101275297
Entry
101275297         CDS       T05247                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oor01009]
    101275297 (AKAP5)
Protein phosphatases and associated proteins [BR:oor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101275297 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101275297
NCBI-ProteinID: XP_004262168
Position
Unknown
AA seq 428 aa
MEITVPEIQVESKDEKRSAEVSPQNERQEEKASTLCFKRRKKAAKAMKPKAGSEAADAAR
KRPPEAGASYQPEPPGGAWASIKRLVTRSKRSDSSKQPKPFEAKVQPEINAEDDNSKKKA
KSRLKIPCIKFSKGEKRSNHSKIIEDSDCSIKVQRQAGSLDTKTLTQSDDQAAKTKSKQD
VREDVSQKGSDEVCESNVNNSITSPGEKVISVELELDTGHSAIQTGTLILEKDIETLEEK
QSIQPQQASPLETSDTEHQLPVVSDVPPSPAVPDQQILEEARNSILESGPDWKDRESKET
VAEESKPKDTELSQESDFQVNEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KQFLISIENEQVGVFANDSGFESRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NAKSNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagatcacagttcctgaaatacaagtagaaagcaaggatgagaagagatcagcagag
gttagtcctcagaatgagaggcaggaggaaaaagcatcgacgctttgcttcaagagaaga
aagaaagcagccaaagcaatgaagcccaaagctggctctgaagctgctgatgcagcaagg
aagcgtcccccagaagcaggagcttcttatcagccagagccccccgggggggcctgggct
tccatcaaacgccttgtaacacgcagcaaaaggtcagattcttcaaagcagccaaagccc
tttgaggccaaagtgcaacctgaaatcaatgctgaggatgataattctaaaaaaaaggca
aaatccagactcaagattccctgtataaaattctcaaaaggggagaaaagaagtaatcat
tccaaaattatagaagactcagactgcagtatcaaagtccaacgacaggctggaagtttg
gatacaaaaactctgacccaatcagatgaccaggcagcaaagaccaagtcgaagcaggat
gtaagggaagatgtctcacagaaagggagtgatgaggtctgtgaatcaaatgtgaacaac
agcataacttctcctggagagaaagtgatttcagtagaacttgagttagatacagggcat
tctgctattcaaacaggaactctaatccttgaaaaagatattgaaacgcttgaggaaaaa
caaagcattcaacctcagcaagcaagcccactggaaacttcagacacagaacaccagctc
ccagtggtttctgatgttcctccctcacctgcagtcccagatcaacaaattctggaagaa
gccagaaacagtatcctagaaagtggaccagactggaaagaccgtgaaagtaaagagact
gttgctgaggagagcaagccgaaagatactgaactgagccaggaatcagattttcaagta
aatgaaatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagcaattcttaatttcaatcgaaaatgagcaagtgggggtttttgctaatgatagtggt
tttgagagtagaacttcagaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttatctatagaacagctggttaatgaaatggcctctgatgat
aatgcaaaaagcaatcttctacagtga

DBGET integrated database retrieval system