KEGG   Orcinus orca (killer whale): 101275975Help
Entry
101275975         CDS       T05247                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00230  Purine metabolism
oor01100  Metabolic pathways
oor04022  cGMP-PKG signaling pathway
oor04270  Vascular smooth muscle contraction
oor04540  Gap junction
oor04611  Platelet activation
oor04713  Circadian entrainment
oor04730  Long-term depression
oor04921  Oxytocin signaling pathway
oor04924  Renin secretion
oor04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101275975 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    101275975 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101275975 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101275975 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101275975 (GUCY1A2)
   04924 Renin secretion
    101275975 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101275975 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    101275975 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    101275975 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101275975 (GUCY1A2)
Enzymes [BR:oor01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101275975 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Motif
Other DBs
NCBI-GeneID: 101275975
NCBI-ProteinID: XP_004284060
Position
Unknown
AA seq 726 aa AA seqDB search
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPPEPSAAAAAGPTPAA
AAPTAATAGARRAQRRRRVNLDSLGESISRLTAPSPQMIQQTLKRTLQYYEHQFTGYRDV
EKNFYNISNRCSYADHSNKEDIEDVSGILQCTANVLGLKFEEIQERFGEEFFNICFDENE
RVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGNLMLHYFHPHHIV
GFAMLGMIKAAGKKIYQLDVEVDQVANEKLCSDGSNPGNCSGLTFLIKQCENTSITKNLP
QGTSQVPADLRISINTFCRAFPFHLMFDPHMTVLQLGEGLRKQLRCDTHKVLRFEDCFEI
VSPKVNATFERVLLRLSTPFVIRTKPEASGTENKDKVMEVKGQMIHVSESNSILFLGSPC
VDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEE
KKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISML
NELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTP
DGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLL
KREESFTFIPRSREELPDNFPKEISGVCYFLEVRTGPKQPKPSLSSSRIKKVSYNIGTMF
LRETSL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtcggagtccttcagctccctgggctccgactacctggag
acgagccccgaggaggagggggagtgccccttgtctaggctctgctggaacggcagccgg
agcccgcccgggccgcccgagcccagcgcggcggccgccgccggcccgaccccggcagcc
gccgcccccaccgccgccacggctggggccaggagagcgcagcgccggaggcgggtcaac
ctggactctctgggagagagcatcagccgcctgacggcgccctcgccccagatgatacag
caaactctcaagaggacattgcagtattatgagcaccaatttactggttatagggatgta
gaaaagaatttctacaatatttctaacagatgctcctatgcagaccattccaacaaagaa
gacattgaagatgtctcaggaattcttcagtgtactgctaacgtactcggtttgaagttt
gaggaaattcaagaaagatttggtgaggagttctttaatatatgctttgatgagaatgag
agagtccttcgagctgtaggtggcacgttgcaggacttttttaatggctttgatgctttg
ttggaacacattagaacttcttttggaaaacaggccactctggagtcaccatcattccta
tgcaaagagctccctgaaggtaatcttatgctccactacttccaccctcaccacattgtg
gggtttgcaatgcttggaatgattaaggctgcaggaaagaaaatctatcagctggatgta
gaagtggaccaggttgcaaatgagaaactgtgctctgatggttcaaacccaggcaattgt
agtggtcttactttccttatcaaacaatgtgaaaatactagtatcacgaagaaccttcca
cagggaacctcccaagttcctgcggacctcagaattagcatcaacaccttctgcagagcc
ttccctttccatttgatgtttgacccccacatgacagtccttcagctgggggaaggccta
aggaagcagctgcgatgtgacactcacaaagtgctcaggtttgaggactgcttcgagatt
gtttctccaaaggttaatgccaccttcgaaagggttctgctgcgactgtccacgccattt
gtgattaggaccaagcctgaggcttctggcactgagaataaagacaaggtgatggaagtt
aaaggacaaatgatccatgtctcagaatcaaattctattttattcttgggttctccatgt
gtggacaagttggatgaactcatgggacgagggctgcatctctcggacatccctatccat
gatgctacccgagatgtaattttggttggtgagcaggcaaaggcccaagatggcttgaag
aagaggatggataaattaaaagcaactttagaaagaactcaccaggccctagaagaagag
aaaaaaaaaacagtggatcttctatattctattttccctggtgatgtagcccagcaattg
tggcaagggcagcaagtgcaagccagaaagtttgatgatgtcaccatgctcttttcagac
attgttggcttcacagccatatgtgcccagtgtacccccatgcaagtaatcagcatgctg
aatgaactgtacacaagatttgaccaccaatgtggatttttggatatttataaggtggaa
acaataggtgatgcatactgtgttgctgcagggctccacagaaaaagcctctgccatgct
aaacccattgctctgatggccctgaagatgatggaactttctgaagaggtgctgacacct
gatggaagaccaattcagatgagaataggcattcactcaggctctgtgctggctggagtt
gttggggtaagaatgccgcgatattgcctgtttggaaataatgtcactctggcaagcaaa
ttcgaatcgggaagtcaccctcgacgcatcaatgtcagcccaaccacttaccaattatta
aaacgagaagaaagtttcacattcattcctcggtcccgtgaagagcttccagacaacttt
ccaaaggaaatctctggggtctgctacttcctggaggtaagaactggtcctaagcagcca
aagccttctctttcttcatcgagaataaaaaaagtttcctacaacattggcacaatgttc
ctccgggagacaagcctctga

DBGET integrated database retrieval system