KEGG   Orcinus orca (killer whale): 101276236Help
Entry
101276236         CDS       T05247                                 

Gene name
ALDOC
Definition
(RefSeq) fructose-bisphosphate aldolase C
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00010  Glycolysis / Gluconeogenesis
oor00030  Pentose phosphate pathway
oor00051  Fructose and mannose metabolism
oor01100  Metabolic pathways
oor01200  Carbon metabolism
oor01230  Biosynthesis of amino acids
oor04066  HIF-1 signaling pathway
Module
oor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oor_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101276236 (ALDOC)
   00030 Pentose phosphate pathway
    101276236 (ALDOC)
   00051 Fructose and mannose metabolism
    101276236 (ALDOC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101276236 (ALDOC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101276236 (ALDOC)
   03036 Chromosome and associated proteins [BR:oor03036]
    101276236 (ALDOC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101276236 (ALDOC)
Enzymes [BR:oor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     101276236 (ALDOC)
Membrane trafficking [BR:oor04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101276236 (ALDOC)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101276236 (ALDOC)
Exosome [BR:oor04147]
 Exosomal proteins
  Proteins found in most exosomes
   101276236 (ALDOC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic LEP503
Motif
Other DBs
NCBI-GeneID: 101276236
NCBI-ProteinID: XP_004267180
Position
Unknown
AA seq 364 aa AA seqDB search
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETLYQKDDNGVLFARTIQDKGIVVGIKVDKGVVPLAGTD
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINQCPLPRPWALTF
SYGRALQASALNTWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYVA
NHAY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccccactcgtacccagccctttctgctgagcagaaaaaggagttgtccgacattgcc
ctccggattgtggccccaggcaaaggcattctggccgcagatgagtctgtaggcagcatg
gccaagcggctgagccaaattggggtggagaacacagaggagaaccgccggttgtaccgt
caggtcctattcagtgccgatgaccgtgtgaagaagtgcatcggaggtgtcatattcttc
catgagacactctaccagaaagatgataatggtgtcctcttcgcccgtaccatccaggat
aagggcattgtcgtgggcatcaaggttgacaagggtgtagtgcctctagccgggactgat
ggagaaaccaccactcaagggctggatggtctctcggaacgctgtgcccagtacaagaag
gatggcgctgacttcgccaagtggcgctgcgtgctgaaaatcagtgaacgcacgccctca
gcacttgccattctggagaatgccaacgtgctggcccgctatgccagcatctgccagcag
aatggcattgtgcctattgtggaacctgagatcctgcctgatggagaccatgacctcaaa
cgttgccagtatgttacagagaaggtcctggctgcagtgtacaaggccctgagtgaccat
cacgtgtacctggaggggaccctgctcaagcccaacatggtgacccctggccatgcctgt
cccattaagtatagcccagaggagatcgccatggcaactgtcactgccctgcgtcgcact
gtgcccccagctgtcccaggagtgacctttctgtctgggggtcagagtgaagaggaggca
tctctcaacctcaatgctatcaaccaatgcccccttccccggccctgggccctcaccttc
tcctatgggcgtgccctgcaggcctctgcactcaacacctggcgagggcaacgggataat
gctggagccgccactgaggagttcatcaagcgggccgaggtgaatggccttgcggcccag
ggcaagtatgaaggcagcggagaagatggtggagcggcagcacaatccctctacgttgcc
aaccacgcctactga

DBGET integrated database retrieval system