KEGG   Orcinus orca (killer whale): 101277237Help
Entry
101277237         CDS       T05247                                 

Gene name
GMPPB
Definition
(RefSeq) mannose-1-phosphate guanyltransferase beta
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00051  Fructose and mannose metabolism
oor00520  Amino sugar and nucleotide sugar metabolism
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    101277237 (GMPPB)
   00520 Amino sugar and nucleotide sugar metabolism
    101277237 (GMPPB)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     101277237 (GMPPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 Hexapep_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 101277237
NCBI-ProteinID: XP_004284004
Position
Unknown
AA seq 360 aa AA seqDB search
MKALILVGGYGTRLRPLTLSIPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVL
EKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAM
VQFHRHHGQEGSILVTKVEEPSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSP
PVLRRIQLQPTSIEKEIFPVMAKEGQLYAMELQGFWMDIGQPKDFLTGMCLFLQSLRQKQ
PEQLCSGPGIVGNVLVDPSARIGENCSIGPNVSLGPGVVVEDGVCIRRCTVLRDAHIRSH
SWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactgattttggtgggtggctatgggacgcgcctgcggccgctgacgctaagc
atcccgaagccgcttgtggacttctgcaataagcctatcttgctgcaccaagtggaggcg
ctggccgcggccggcgtggaccacgtgattctggctgtgagctatatgtctcaggtgctg
gagaaggaaatgaaggcgcaggagcaaaggctaggaatccgaatctctatgtcccatgaa
gaggagcctttaggaacagctgggcccctggcactggcccgtgacttgctctctgagact
gcagacccttttttcgtcctcaacagtgacgtgatctgcgatttcccctttcaagccatg
gtgcagttccaccggcaccatggccaggagggctcaattctggtgaccaaagtggaggaa
ccctctaagtatggcgtggtagtgtgtgaggcggacacaggccgcattcaccggttcgtg
gagaagccgcaggtgtttgtttccaacaagatcaacgcaggcatgtacatcctgagccct
ccagtgctacggcgcatccagctgcagcccacatccattgagaaggagatcttccctgtc
atggccaaggaggggcagctctatgccatggagttgcagggcttctggatggacattggg
cagcccaaggatttcctcaccggcatgtgcctcttcctgcagtcgctgcgacagaagcag
cctgagcaactgtgctcaggccccggcattgtgggcaacgtgctggtggacccaagtgcc
cgtattggcgagaactgcagcattggccctaatgtgagtctgggtcctggtgtggtggtg
gaggatggtgtgtgcattcggcggtgcacggtgctgcgagatgcccacattcgctcccac
tcctggcttgagtcctgcattgtaggctggcgctgccgcgtgggccagtgggtgcgcatg
gagaacgtgacagtgctgggtgaggacgtcatagttaacgacgagctctacctcaacggg
gccagtgtgctgccccacaagtctattggtgagtcggtgccggagccccgcatcatcatg
tga

DBGET integrated database retrieval system