KEGG   Orcinus orca (killer whale): 101277631Help
Entry
101277631         CDS       T05247                                 

Gene name
CDK18
Definition
(RefSeq) cyclin-dependent kinase 18
  KO
K15596  cyclin-dependent kinase 18 [EC:2.7.11.22]
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101277631 (CDK18)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101277631 (CDK18)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101277631 (CDK18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 101277631
NCBI-ProteinID: XP_004282493
Position
Unknown
AA seq 471 aa AA seqDB search
MNKMKNFKRRFSLSVPRTETIEESLVEFTEQFNQLHSRHNEGLQLHPLGRDPQPESSTFS
PADRGEDPGQLSPGMQYRRQNQRRFSMEDISKRLSLPMDIRLPQEFLQKLQLESPDLPKP
LTRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGA
PCTAIREVSLLRNLKHANIVTLHDLIHTERSLTLVFEYLDSDLKQYLDHCGNLMSMHNVK
IFMFQLLRGLAYCHRRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVT
LWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEE
TWPGVMALSEFRAYNFPQYLPQPLISHAPRLDTDGINLLTGLLLYESKSRVSAEAALRHP
YFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKSRRQSIF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatgaagaactttaagcgccgcttctccctgtcagtgccccgcaccgagacc
atcgaggagtccttggtcgagttcacagagcagttcaaccagctccacagccggcacaat
gagggcctgcagctccatcctctgggcagagacccccagccagagtccagcaccttctcc
cccgcagacagaggggaggaccccgggcagctgtcccctggcatgcagtaccggcggcag
aaccagcgccgcttctccatggaggacatcagtaagaggctctctctgcccatggacatc
cgtctgccccaggaattcctccagaagctgcagctggagagcccagacctgcccaaaccg
ctcacccgaatgtcccgccgtgcctccctgtcagatatcggctttgggaaactggaaaca
tacgtgaaactggacaaactgggggagggaacctatgccacggtcttcaaagggcgcagc
aaactgacagagaaccttgtggccctgaaggagatccggctggaacatgaagaaggcgcg
ccctgcactgccatccgagaggtgtctttgctgaggaacctgaaacatgccaatattgtg
accctgcatgacctcatccacacggagcgctccctcactctggtgtttgagtacctggac
agtgacctgaagcagtatctggaccactgtggaaacctcatgagcatgcacaacgtcaag
attttcatgttccagctgctccggggccttgcctactgccaccgacgcaagatcctgcac
cgggacctgaaaccccagaacctgctcatcaacgagagaggggagctgaagctggccgac
ttcggactggcccgggccaagtcagtgcccacgaagacctactccaatgaggtggtgacc
ctgtggtacaggccccccgacgtgctgctggggtccacggagtactccacccccatcgat
atgtggggcgtgggctgcatccattacgagatggccacagggaggcccctcttccccggc
tccacggttaaggaggagctgcacctcatcttccgactcctcgggacccccacggaagag
acgtggcctggtgtgatggccctgtccgagttccgagcgtacaacttcccccagtacctg
ccccagccgctcatcagtcatgctcccaggttggacactgatggcatcaacctcctgacc
ggcctcctcctgtacgagtccaagagtcgcgtgtcagcagaggcggccctgaggcacccc
tacttccggtctctgggggagcgtgtgcaccagctcgaagacactgcttccatcttctcc
ctgaaggagatccagctccagaaggacccaggctaccggggcctggcctttcagcagcca
gggcgagggaagagccggcggcagagcatcttctga

DBGET integrated database retrieval system