KEGG   Orcinus orca (killer whale): 101277656Help
Entry
101277656         CDS       T05247                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04024  cAMP signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04137  Mitophagy - animal
oor04140  Autophagy - animal
oor04141  Protein processing in endoplasmic reticulum
oor04210  Apoptosis
oor04215  Apoptosis - multiple species
oor04217  Necroptosis
oor04310  Wnt signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04530  Tight junction
oor04620  Toll-like receptor signaling pathway
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04625  C-type lectin receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04668  TNF signaling pathway
oor04722  Neurotrophin signaling pathway
oor04723  Retrograde endocannabinoid signaling
oor04728  Dopaminergic synapse
oor04750  Inflammatory mediator regulation of TRP channels
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04917  Prolactin signaling pathway
oor04920  Adipocytokine signaling pathway
oor04926  Relaxin signaling pathway
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04932  Non-alcoholic fatty liver disease (NAFLD)
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04935  Growth hormone synthesis, secretion and action
oor05132  Salmonella infection
oor05133  Pertussis
oor05135  Yersinia infection
oor05142  Chagas disease (American trypanosomiasis)
oor05145  Toxoplasmosis
oor05152  Tuberculosis
oor05161  Hepatitis B
oor05162  Measles
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05231  Choline metabolism in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101277656 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101277656 (MAPK10)
   04010 MAPK signaling pathway
    101277656 (MAPK10)
   04012 ErbB signaling pathway
    101277656 (MAPK10)
   04310 Wnt signaling pathway
    101277656 (MAPK10)
   04668 TNF signaling pathway
    101277656 (MAPK10)
   04068 FoxO signaling pathway
    101277656 (MAPK10)
   04071 Sphingolipid signaling pathway
    101277656 (MAPK10)
   04024 cAMP signaling pathway
    101277656 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101277656 (MAPK10)
   04137 Mitophagy - animal
    101277656 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    101277656 (MAPK10)
   04215 Apoptosis - multiple species
    101277656 (MAPK10)
   04217 Necroptosis
    101277656 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101277656 (MAPK10)
   04530 Tight junction
    101277656 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101277656 (MAPK10)
   04621 NOD-like receptor signaling pathway
    101277656 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    101277656 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    101277656 (MAPK10)
   04660 T cell receptor signaling pathway
    101277656 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    101277656 (MAPK10)
   04659 Th17 cell differentiation
    101277656 (MAPK10)
   04657 IL-17 signaling pathway
    101277656 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    101277656 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101277656 (MAPK10)
   04920 Adipocytokine signaling pathway
    101277656 (MAPK10)
   04912 GnRH signaling pathway
    101277656 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    101277656 (MAPK10)
   04917 Prolactin signaling pathway
    101277656 (MAPK10)
   04926 Relaxin signaling pathway
    101277656 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    101277656 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    101277656 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    101277656 (MAPK10)
   04722 Neurotrophin signaling pathway
    101277656 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101277656 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101277656 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101277656 (MAPK10)
   05231 Choline metabolism in cancer
    101277656 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101277656 (MAPK10)
   05212 Pancreatic cancer
    101277656 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101277656 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101277656 (MAPK10)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101277656 (MAPK10)
   04931 Insulin resistance
    101277656 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101277656 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101277656 (MAPK10)
   05135 Yersinia infection
    101277656 (MAPK10)
   05133 Pertussis
    101277656 (MAPK10)
   05152 Tuberculosis
    101277656 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101277656 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    101277656 (MAPK10)
   05162 Measles
    101277656 (MAPK10)
   05161 Hepatitis B
    101277656 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101277656 (MAPK10)
   05169 Epstein-Barr virus infection
    101277656 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101277656 (MAPK10)
   05142 Chagas disease (American trypanosomiasis)
    101277656 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101277656 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101277656 (MAPK10)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101277656 (MAPK10)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101277656 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101277656
NCBI-ProteinID: XP_004285469
Position
Unknown
AA seq 464 aa AA seqDB search
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAALDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNTSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgctcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaatattattagtttattaaatgtcttcacaccccagaaaacgctggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggacttgaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctagactttggactggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcaactagga
acaccatgcccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggacgacgccttacagcatccgtacatcaat
gtgtggtatgatcctgccgaagtggaggcgcccccaccccagatatacgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtcatgaat
tcagaagaaaagactaagaatggtgttgtgaaaggacagccttctccttcaggtgcagca
gtgaacaccagtgagagtctccctccatcctcgtctgtcaacgatatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

DBGET integrated database retrieval system