KEGG   Orcinus orca (killer whale): 101277997
Entry
101277997         CDS       T05247                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oor03000]
    101277997 (AHRR)
Transcription factors [BR:oor03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101277997 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 101277997
NCBI-ProteinID: XP_012390162
Position
Unknown
AA seq 698 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDRLAGLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQVSGEQTLQQPAAGAPSPEDRDPRGGSAVLEGRLLLESLH
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
GCGQNLLSETGEDAVLGRLLRAQEGAAGWPTEYSAFLTRCFICRVRCLLDSTSGFLTMQF
QGKLKFLFGQKRRAPSGAALPPRLSLFCVVAPLPTAVKMQSVCLRAKHRVDASATPDTKA
KAAASLCEPELHGKPSYLAGRGSGGNGLSVFRRPADACHWGRLATRGPCLCLRGGHDLLH
PHPEGAAGDGRGEELGGLPRGPSCPRERRDVPPYSCHLEAQGPSKHLNWTPGRHGQDGGT
KLKLEPGKGDPFPAAQARGACLPYPGTQGTVHAVRSSPGSHQPKPPPGPCASRTSTGLQD
GHQGQAPLPTSCPFPQGSLEDGLPRPGGQRLPTGCYPTEDKLRGIPMPPGAPCNPMLSLD
VPIKMESESGSEDAADGYCVSPSQAWLGASDVAKRQLVTFPTRMHLKMEPDSRHPLYSPP
LGPGLLGPHPRPGRELAPLHPAHCACLEPPPRLCAGGHQPPSLGCDCQAAGPVPVVKLEP
LDSPPWAAHGQGGAPGMLPRSTLATRMPPRDPECTFLP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgattccgccgggggagtgcctgtatgccgggaggaaaagaaggaagcccgttcagaaa
cagaggcccgccgtgggcgccgagaagtcgaacccttccaagagacaccgggatcgcctc
aacgccgagctggaccgcctagccggcctgctgccactgccccccgacatcatctctaag
ctggacaagctttcggtcctgcgcctcagcgtcagttacctccgggtgaagagcttcttc
caagtttctggggagcagaccctgcagcagccggcggccggtgccccctcaccagaagac
agggatccgcgtggagggtctgctgtgctggagggaaggctgctactggagtccctgcac
ggctttgctctggtggtgagcgcagaagggatgatattctacgcgtcagcaacgatcgtg
gactatctgggcttccaccagacggacgtgatgcaccagaacatctatgactacatccac
gtggacgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggct
gggtgtgggcagaacctgctctcagagacaggagaggacgccgtcctggggaggctgctc
cgggcccaggagggggccgcgggctggcccaccgagtactcggccttcctgacgcggtgc
ttcatttgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcagttt
caagggaaactaaaattcctgttcgggcagaagaggagggccccgtcgggagccgccctg
ccccctcggctctccctgttctgcgtcgtggcgcccctgcctactgcggtgaagatgcag
agtgtgtgtctgagggcgaagcacagggtggacgcctcggccacgccggacacaaaagca
aaagctgccgcaagtctctgtgaaccagaattgcacggaaaacccagttacttagcaggg
aggggcagcggaggaaacggcctgtctgtgttcaggaggcccgcagacgcctgccactgg
ggccggctggcaacccggggcccctgcctgtgcctgcggggcggccacgacctcctccac
ccccaccccgagggggccgcaggggatgggcgaggagaggaactgggggggttgccgagg
ggcccctcctgcccaagggagcggagggacgtccccccgtacagctgccacctcgaggca
cagggaccctcgaagcacctgaactggacgccggggagacacggtcaggacggcggcacc
aagctgaagctggagcccggcaagggtgacccattccccgccgcgcaggcccgtggcgcc
tgcctgccctacccgggcacccagggcactgtccacgccgtcaggagctcacctggctct
caccagccaaagcctccccccgggccctgcgccagccggaccagcacaggcttgcaggac
ggccaccagggccaggctcccctacccaccagctgccccttccctcaggggagcctggag
gacgggcttcctcggccaggagggcagcgtctccccacggggtgctatcccaccgaggac
aagcttcgaggcatcccaatgcccccgggagccccgtgtaaccccatgttgtcactcgat
gtgcccatcaagatggagagcgaatccgggtccgaggatgcggcggatggctactgtgtg
tccccgagccaggcgtggctgggggccagcgacgtggccaagagacagctggtcactttc
cctaccaggatgcacctgaagatggagccggactccaggcaccccctctacagcccaccc
ctggggcccggcctgctggggccccaccccaggcccggcagggagctggccccgttgcac
cccgcacactgcgcctgcctggagcctccaccccgcctctgtgctgggggccaccaaccc
cccagcctgggctgtgactgccaggctgccgggcctgtgcctgtagtcaagcttgagccc
ctggactcgcccccgtgggccgctcacggccagggcggggcgcccggcatgctccccagg
agcaccttggcgacacggatgccacccagagaccccgagtgcacgttcctgccgtag

DBGET integrated database retrieval system