KEGG   Orcinus orca (killer whale): 101278048Help
Entry
101278048         CDS       T05247                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00010  Glycolysis / Gluconeogenesis
oor00562  Inositol phosphate metabolism
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101278048 (MINPP1)
   00562 Inositol phosphate metabolism
    101278048 (MINPP1)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101278048 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101278048 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 101278048
NCBI-ProteinID: XP_004285393
Position
Unknown
AA seq 486 aa AA seqDB search
MLRGPCCLFRVSVAPVAALAVALVSSLSRCSLLEPENRVVSPLSPYFGTKTRYEDANPGL
LPDPEAPRRDPQLLEETCTPVQLVALIRHGTRYPTTKQIRKLRQLHGLLQARGPGDDRIR
PAGGGDLGAVLANWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPVLFSRENCGRLQLV
TSSKHRCMDSGAAFLQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVE
RNATALYHVEAFKTGPEMQNILKKVAGILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSP
WCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSQSSCTLFQDIFQHLDKAVEQKQSFQPV
SSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLY
HCKNAKTPKEEFQVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKV
NTSDEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtggcccttgctgcctcttcagggtttccgtggcacccgtcgcggccctggct
gtggcgctggtctcgtcgctctctcgctgctccctcctggagccggagaaccgcgtggtc
tcgccgctcagcccctacttcggcaccaagactcgctacgaggatgccaaccccgggctg
ctgccggaccccgaggcgccacggcgggacccacaactgctggaggagacctgcaccccg
gtacagctggtcgccctcatccgccacggcacccgctacccgaccaccaaacagatccgc
aagctgcggcagctgcacggactgctgcaggcccgcgggcccggggatgaccggatccgc
cctgccggcggcggcgacctgggcgctgtgctggccaactggccgctgtggtacgcggac
tggatggacgggcagctggtggagaaggggcggcaggacatgcgacagctggccctgcgc
ctggcctcccttttcccggtcctcttcagccgagaaaactgcggccgcctgcagctagtc
accagctccaagcaccgctgcatggacagcggcgccgccttcctgcagggactgtggcag
cactaccaccctgggttaccgccgcccgacgtcgcagacatggagtgtggacctccaaga
attaatgataaattaatgaggttctttgatcattgtgagaagtttttaactcaagtggaa
aggaatgctacggctctttatcatgtagaagccttcaaaactggaccagaaatgcagaac
attttaaaaaaagttgcaggtattttgcaagtgccagtcaacaacttaaatgcagattta
attcaggtagcttttttcacctgttcatttgacctggcaattaaaggtgttaaatctcct
tggtgtgatgtttttgacatagatgatgcaaaggttttagaatacttaaatgatctgaaa
caatattggaaaagaggatatgggtatacgattaatagtcaatccagctgcaccctgttt
caggatatctttcagcacttggacaaagcagttgaacagaaacaaagttttcaaccagtt
tcctctccagtcatccttcagtttggtcatgcagagacccttcttccactgctttctctc
atgggctacttcaaagacaaggagcccctaacagcttacaattacaaggagcaaatgcat
cggaagttccgaagtggtcacattgtaccctatgcctcaaacctaatatttgtgctttac
cattgtaaaaatgctaagactcctaaggaagaattccaagtgcagatgttactgaatgaa
aaggtgttaccattggctcactcccaagaaactgtttctttgtatgaagatctgaagaac
cactacaaggacatccttcagagttgtcacaccagtgaagaatgtgaactaccaaaggtg
aacacatctgatgagctatga

DBGET integrated database retrieval system